SecReT4
Protein ID: 339319745
T4SS name [ID]VirB [509]
Gene symbolvirB8
Locus tagmidi_00447
StrainCandidatus Midichloria mitochondrii IricVA
Repliconchromosome [GenBank: NC_015722] [Browse all T4SS(s) in this replicon]
Location [Strand]418641..419348 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDF7XVQ5
KEGG IDmmn:midi_00447
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-42, Aligned region: 26..232
Protein Sequence: 235 a.a.     [Download]
>gi|339319745|ref|YP_004679440.1| type IV secretion system protein VirB8 [Candidatus Midichloria mitochondrii IricVA]
MGLKDFFARLKNKQGVATPSDVAVLRNWYKERYESTVIQRNLLFVISVASLVIITFSVFVIRYVRSTRSI
EPFIIEIERKTGVPTVVDPVTIEAYSANVSVKRYFVWRYITAREEYFPSTYTYNYTTTVRVLSTPEVYFG
DYRPKYSMANPTSPYNLYSQGSSRTVKLKSMIFTNDSSAQVRISMEVTGLMNMKMDKIVFIEFDFQNIEM
NDEERLINPLGFRVKLYRIEDERIQ
 
Nucleotide Sequence: 708 bp     [Download]
>gi|339319317|ref|NC_015722.1|:c419348-418641 Candidatus Midichloria mitochondrii IricVA chromosome, complete genome
ATGGGATTAAAGGATTTTTTTGCAAGACTAAAGAATAAACAAGGGGTTGCCACGCCTTCGGACGTAGCGG
TACTACGTAACTGGTATAAAGAGAGGTACGAAAGCACCGTTATCCAGCGTAATCTTTTATTTGTCATATC
AGTCGCGTCGCTGGTAATAATTACCTTTTCCGTTTTCGTGATCAGATATGTCAGAAGCACCAGATCTATA
GAGCCCTTCATCATTGAAATAGAGAGAAAAACAGGCGTACCAACCGTGGTTGATCCAGTAACAATTGAGG
CATATTCCGCTAATGTGTCCGTAAAACGTTATTTTGTCTGGAGATATATAACAGCAAGAGAAGAATATTT
TCCTTCGACGTATACATATAATTATACAACCACTGTGAGGGTATTATCAACCCCAGAAGTATACTTTGGC
GACTACAGGCCAAAATATAGTATGGCTAATCCGACAAGCCCCTATAATTTATACTCTCAAGGTAGTAGTC
GAACTGTTAAATTAAAATCCATGATATTTACTAATGACTCCTCTGCTCAAGTTAGAATTTCAATGGAAGT
TACTGGTTTAATGAATATGAAGATGGATAAAATAGTTTTCATTGAATTTGATTTTCAGAACATTGAAATG
AACGATGAGGAAAGATTAATAAATCCTTTGGGTTTTAGGGTTAAGTTATATAGGATAGAGGATGAGAGAA
TTCAGTAG
 Primer design