SecReT4
Protein ID: 339320171
T4SS name [ID]VirB [509]
Gene symbol-
Locus tagmidi_00896
StrainCandidatus Midichloria mitochondrii IricVA
Repliconchromosome [GenBank: NC_015722] [Browse all T4SS(s) in this replicon]
Location [Strand]843075..843785 [-]
Productputative type IV secretion system protein
Component typeVirB8
UniProt IDF7XWY1
KEGG IDmmn:midi_00896
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.6e-13, Aligned region: 34..211
Protein Sequence: 236 a.a.     [Download]
>gi|339320171|ref|YP_004679866.1| putative type IV secretion system protein [Candidatus Midichloria mitochondrii IricVA]
MITELHQQIESGEYFEKARNWYADRYLGVNTQVIASSIFLLIISTGAYFVVDSMMDKYFAVKYPVPIYVD
DQVDFQSRIKSLAQGYESIDTSVVRYLIAYYVINREEYRYNGLNQDIIQEKLLSIRSTSSRRVYTNYLNY
MDPQKNPDSPILKYKLQIERTISIESIKFPEGVNRPNTAHVIFKAIEKNSTKESASYWLAEINFSLNSIT
NVLDYKSNLNFIVTAYKTMKKTDYKG
 
Nucleotide Sequence: 711 bp     [Download]
>gi|339319317|ref|NC_015722.1|:c843785-843075 Candidatus Midichloria mitochondrii IricVA chromosome, complete genome
ATGATTACCGAGTTGCATCAGCAAATAGAAAGTGGTGAATATTTTGAAAAGGCTCGTAACTGGTATGCTG
ACAGATATCTTGGCGTCAATACCCAAGTTATTGCTTCATCTATATTTTTGCTAATCATATCAACAGGAGC
CTATTTTGTGGTGGATTCAATGATGGATAAGTATTTCGCGGTTAAGTATCCGGTTCCTATATATGTTGAT
GATCAGGTGGACTTTCAATCCAGGATAAAGTCGCTAGCGCAAGGTTATGAATCCATAGACACTTCAGTGG
TTAGGTATCTAATCGCCTACTATGTAATCAATAGAGAAGAATACAGGTATAATGGCCTTAACCAAGATAT
AATCCAAGAAAAACTTTTATCTATAAGGTCAACCTCCTCCAGGCGAGTTTATACAAATTATTTAAATTAT
ATGGATCCTCAAAAAAATCCAGATAGTCCTATATTGAAATATAAATTACAGATAGAAAGAACTATCTCTA
TAGAATCAATAAAATTTCCAGAAGGAGTTAATAGGCCAAATACTGCGCATGTGATCTTTAAAGCTATAGA
AAAGAATTCCACTAAAGAAAGTGCTTCATATTGGCTTGCTGAAATAAACTTTAGTTTGAATAGTATAACT
AATGTTCTAGACTATAAGAGTAATTTAAATTTTATTGTCACAGCTTATAAAACCATGAAAAAAACAGATT
ACAAAGGTTAG
 Primer design