SecReT4
Protein ID: 339326872
T4SS name [ID]Tfc [741]
Gene symbol-
Locus tagCNE_1c27700
StrainCupriavidus necator N-1
Repliconchromosome 1 [GenBank: NC_015726] [Browse all T4SS(s) in this replicon]
Location [Strand]2874021..2875424 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDG0ETN5
KEGG IDcnc:CNE_1c27700
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 467 a.a.     [Download]
>gi|339326872|ref|YP_004686565.1| hypothetical protein CNE_1c27700 [Cupriavidus necator N-1]
MKVFYSCMTGRARPYALIIALACAVTAAAGVTWAQTHIDRNGASASGSVIGDDVLYSVGGGRAVSMSGAG
NMKSIGVGVGWNSNLICGDMSLTTTLQNQLNGATSGFQSIMSSVIQNATSAVASLPALIIQRADPALYNL
LANGVLQARLDFDRSKMTCRAIANRMADLAGGQAGWDQLAEGMALRNAVSSTDAVSAIARAESNKGNNGV
PWVGGRNAGGSSQSPIKVVSDVTRAGYNLLNGRDVTETSSIPPASCGNRLTCLTWSSPQAAINFATRVLG
EREQRTCDNCTKTQTTPGVGLTPVIQEEYEAKLQALQELVTGVKPTTVANLEAAGSNSLPITRGVIEALR
DEPDQDLLGKRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVKEVDRENGTLEQEINNVKIELE
LRRTLAGNSALAIVQRHDTRAGGSRGIFEGDTTRDRLKEVQKPRSTP
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|339324158|ref|NC_015726.1|:c2875424-2874021 Cupriavidus necator N-1 chromosome 1, complete sequence
ATGAAGGTGTTCTATTCCTGCATGACAGGGCGTGCTAGGCCCTACGCGTTGATTATCGCGCTCGCTTGCG
CCGTCACGGCGGCAGCTGGCGTCACGTGGGCGCAGACCCATATCGACCGCAATGGCGCAAGCGCGAGCGG
CAGCGTCATTGGCGATGACGTGCTCTACAGTGTGGGCGGTGGCCGGGCCGTGTCCATGAGCGGGGCTGGG
AACATGAAAAGCATCGGCGTCGGTGTCGGCTGGAACAGCAACCTTATCTGCGGGGACATGAGTCTAACGA
CGACGCTGCAGAACCAGCTGAACGGTGCCACTAGCGGCTTCCAGTCCATCATGTCCTCAGTGATCCAGAA
CGCCACCAGCGCCGTGGCGTCGCTGCCGGCGCTGATCATCCAGCGCGCGGATCCGGCGCTCTACAACCTG
TTAGCCAACGGCGTGCTGCAGGCGCGCCTGGACTTCGACCGCTCCAAGATGACCTGCCGGGCCATCGCCA
ACCGGATGGCGGATTTGGCCGGCGGCCAGGCGGGCTGGGACCAACTCGCCGAGGGTATGGCGCTGCGCAA
TGCGGTGAGTAGTACCGATGCCGTGTCAGCTATCGCGCGGGCCGAATCGAACAAGGGCAACAACGGCGTG
CCATGGGTAGGCGGCCGCAATGCGGGCGGCTCTAGCCAGAGTCCAATCAAGGTGGTGAGCGACGTAACGC
GTGCGGGCTACAATTTGCTCAACGGGCGCGACGTCACGGAGACGTCATCGATTCCGCCTGCGTCCTGCGG
CAATAGGCTGACGTGCCTCACGTGGTCCTCGCCACAGGCTGCTATCAACTTCGCCACCCGTGTGTTGGGC
GAGCGCGAGCAGCGCACCTGCGACAACTGCACCAAGACGCAGACCACGCCGGGCGTCGGCCTCACGCCGG
TGATTCAGGAAGAGTACGAAGCCAAACTGCAGGCACTGCAGGAGCTGGTGACGGGTGTGAAGCCGACGAC
AGTAGCGAACCTCGAGGCGGCCGGCAGCAATTCGCTGCCGATCACCCGCGGCGTGATCGAAGCCCTGCGA
GACGAGCCCGACCAGGATTTGCTGGGCAAGCGGCTGGCTTCCGAGGTGGCGCTGTCAAGTGTGCTGGAGA
AGGCCTTGCTGCTGCAGCGCACGCTGCTGACCGGCAAGAAGGAGCCGAACGTCGCAGCCAATGAGTTGGC
CGTGAAGGAGGTCGACCGGGAGAACGGCACGCTGGAGCAGGAGATCAACAACGTCAAGATCGAGCTGGAG
TTGCGGCGCACACTGGCCGGGAACTCCGCCTTGGCGATCGTGCAGCGCCACGACACCCGCGCCGGCGGAT
CGCGCGGCATCTTCGAGGGCGACACCACGCGCGATCGGCTCAAGGAAGTGCAGAAGCCGCGGAGCACGCC
GTGA
 Primer design