SecReT4
Protein ID: 339326882
T4SS name [ID]Tfc [741]
Gene symbol-
Locus tagCNE_1c27800
StrainCupriavidus necator N-1
Repliconchromosome 1 [GenBank: NC_015726] [Browse all T4SS(s) in this replicon]
Location [Strand]2884828..2885277 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDG0ETP5
KEGG IDcnc:CNE_1c27800
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.9e-44, Aligned region: 19..138
Protein Sequence: 149 a.a.     [Download]
>gi|339326882|ref|YP_004686575.1| hypothetical protein CNE_1c27800 [Cupriavidus necator N-1]
MTGYPQNPRQAAQDGLNDGLVVFLPHRLNRHPVVIRGLTADELWACAGLSGVAGFLTGLAAAWLTQSIAM
VPTLVVVGIGIGVFGGGGFLRRKKRGRPDTWLYRQLQWRLALRYPSLAAQVGGRQIIAYSGWWTTRREWP
STSIRRGAA
 
Nucleotide Sequence: 450 bp     [Download]
>gi|339324158|ref|NC_015726.1|:c2885277-2884828 Cupriavidus necator N-1 chromosome 1, complete sequence
ATGACCGGCTACCCCCAGAACCCGAGGCAGGCTGCGCAGGATGGTCTCAATGATGGGCTCGTCGTCTTCC
TGCCGCATCGCTTGAACCGCCATCCGGTGGTGATACGCGGATTGACTGCCGACGAGCTGTGGGCCTGCGC
CGGCTTGTCCGGTGTGGCCGGCTTCCTGACAGGCTTGGCGGCGGCCTGGCTGACCCAGAGTATTGCCATG
GTGCCGACCCTGGTCGTCGTTGGCATCGGGATCGGCGTGTTCGGGGGTGGCGGCTTCCTGCGCCGGAAGA
AGCGCGGTCGGCCTGACACCTGGCTATACCGCCAGCTCCAGTGGCGGCTCGCGCTGCGCTACCCCTCGCT
GGCTGCTCAAGTAGGCGGACGGCAGATCATCGCTTACTCTGGCTGGTGGACCACACGGCGCGAGTGGCCT
TCCACATCCATTCGTCGGGGCGCCGCATGA
 Primer design