SecReT4
Protein ID: 339326885
T4SS name [ID]Tfc [741]
Gene symbol-
Locus tagCNE_1c27830
StrainCupriavidus necator N-1
Repliconchromosome 1 [GenBank: NC_015726] [Browse all T4SS(s) in this replicon]
Location [Strand]2885915..2886277 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDG0ETP8
KEGG IDcnc:CNE_1c27830
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1e-28, Aligned region: 32..109
Protein Sequence: 120 a.a.     [Download]
>gi|339326885|ref|YP_004686578.1| hypothetical protein CNE_1c27830 [Cupriavidus necator N-1]
MKQTCRRTGAWSRRIVILLLLLSFSSLRAAMASNGAMEREQLGALARQIELADSIAAHAANTAMDERARY
HFDYARLHADLERVRAGVQDYLAPERAQPRDPVPIAGDYVRSHEPQESSP
 
Nucleotide Sequence: 363 bp     [Download]
>gi|339324158|ref|NC_015726.1|:c2886277-2885915 Cupriavidus necator N-1 chromosome 1, complete sequence
ATGAAACAAACATGCCGACGCACTGGCGCGTGGTCACGCCGGATAGTCATCTTGCTCCTGTTGCTTTCGT
TCTCAAGTTTGCGTGCGGCCATGGCTTCCAATGGCGCCATGGAGCGTGAGCAACTCGGCGCCTTGGCGCG
TCAGATTGAACTGGCGGACAGCATCGCAGCGCACGCCGCCAACACCGCAATGGATGAACGTGCCCGCTAC
CACTTCGATTATGCCCGGCTGCATGCTGACCTTGAGCGCGTCCGTGCAGGCGTGCAGGACTACCTCGCCC
CCGAGCGTGCCCAGCCGCGCGATCCCGTTCCCATCGCCGGCGACTACGTACGAAGCCATGAACCGCAGGA
GTCATCGCCATGA
 Primer design