SecReT4
Protein ID: 339326887
T4SS name [ID]Tfc [741]
Gene symbol-
Locus tagCNE_1c27850
StrainCupriavidus necator N-1
Repliconchromosome 1 [GenBank: NC_015726] [Browse all T4SS(s) in this replicon]
Location [Strand]2886595..2887344 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDG0ETQ0
KEGG IDcnc:CNE_1c27850
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3.1e-67, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|339326887|ref|YP_004686580.1| hypothetical protein CNE_1c27850 [Cupriavidus necator N-1]
MSDPVVAAQRQQVYQQGLVASVITLPFRIFGVLCGSLLLCIVIECIGLHFFWPQQGWRHAQSMLNHELAL
VSESFTRGVMVQEPGRTARHLVELAYDWLFVKSGLLDVIRDAATQASAGVRSQAHDLRYYLGVVYVHVES
YLIASAYTALVFLVRLLVLTLTLPLFLMAAFVGLVDGLVRRDVRSFAAGRESGFVYHRAKASLMPLAILP
WVIYLALPVSVHPLLILLPSASMLGVAVCISAATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|339324158|ref|NC_015726.1|:c2887344-2886595 Cupriavidus necator N-1 chromosome 1, complete sequence
ATGAGCGATCCGGTCGTCGCAGCGCAGCGCCAGCAGGTCTACCAACAGGGGCTGGTCGCGAGTGTCATCA
CCTTGCCGTTCCGCATCTTTGGTGTGCTGTGCGGCTCACTGCTTTTGTGCATCGTGATCGAATGCATCGG
GTTGCACTTCTTCTGGCCTCAACAGGGCTGGCGTCACGCGCAGAGCATGCTCAATCACGAGTTGGCCCTG
GTATCGGAGAGCTTTACGCGCGGCGTGATGGTGCAGGAACCAGGCCGCACCGCTCGGCATCTTGTCGAGC
TGGCCTACGACTGGCTTTTCGTCAAAAGCGGGCTGCTCGACGTGATACGCGATGCCGCTACGCAGGCAAG
CGCCGGTGTCCGCAGCCAGGCACATGATTTGCGCTACTACCTTGGCGTGGTCTATGTGCATGTTGAGAGC
TACTTGATCGCCTCCGCCTACACTGCTCTCGTGTTTCTCGTGCGGCTGCTGGTGCTGACGCTGACCTTGC
CGCTGTTTTTGATGGCCGCCTTCGTTGGCCTGGTGGATGGGCTAGTTCGGCGTGACGTGCGCAGCTTCGC
AGCCGGCCGCGAATCGGGATTCGTCTACCACCGAGCGAAGGCGAGCCTGATGCCGCTGGCCATTCTGCCG
TGGGTCATTTACCTGGCGCTGCCGGTGAGCGTTCATCCGCTGCTAATCCTGTTGCCCAGCGCGTCAATGC
TGGGCGTAGCCGTATGCATCTCCGCCGCGACGTTCAAGAAGTATCTCTAG
 Primer design