SecReT4
Protein ID: 339326890
T4SS name [ID]Tfc [741]
Gene symbol-
Locus tagCNE_1c27880
StrainCupriavidus necator N-1
Repliconchromosome 1 [GenBank: NC_015726] [Browse all T4SS(s) in this replicon]
Location [Strand]2890072..2890647 [-]
Productlytic transglycosylase
Component typeTfc4
UniProt IDG0ETQ3
KEGG IDcnc:CNE_1c27880
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 191 a.a.     [Download]
>gi|339326890|ref|YP_004686583.1| lytic transglycosylase [Cupriavidus necator N-1]
MAAAVNPQSALRVALLLVACVWASVAPAQEEPPPAYQIAAKHAGVPSPVLYAVALQESGTRLRGRLIPWP
WTLNVAGRGERYATRAQTCARLRQALTRIPANRIDAGLGQVNLGYQAHRYSHPCELLDPYRNLAIVAEIL
MEQYKEGEDWLAAIGRYHRPAGGAPAARYRRSVHQHLVRVLGPRTTPSAIK
 
Nucleotide Sequence: 576 bp     [Download]
>gi|339324158|ref|NC_015726.1|:c2890647-2890072 Cupriavidus necator N-1 chromosome 1, complete sequence
ATGGCAGCGGCAGTAAATCCGCAATCCGCGTTGCGTGTCGCGCTCCTGCTAGTCGCCTGCGTCTGGGCAT
CAGTTGCGCCCGCGCAAGAGGAGCCGCCGCCGGCCTACCAGATTGCCGCGAAGCACGCAGGTGTGCCGTC
GCCAGTACTGTACGCGGTGGCCTTGCAGGAGAGCGGCACCAGACTGCGTGGACGGTTGATTCCTTGGCCG
TGGACACTCAATGTTGCGGGGAGGGGCGAGCGTTATGCCACGCGGGCTCAGACCTGCGCGCGCTTGCGCC
AAGCGCTCACCCGCATCCCAGCCAACCGGATCGACGCCGGCCTCGGGCAGGTCAATCTCGGTTACCAGGC
GCATCGCTACAGTCATCCCTGCGAGCTCCTCGACCCTTACAGGAATCTCGCGATCGTCGCGGAAATTCTC
ATGGAGCAGTACAAAGAGGGCGAGGACTGGCTAGCCGCCATCGGTCGCTACCACCGTCCAGCCGGCGGCG
CACCGGCCGCTCGTTACCGCCGCAGTGTTCATCAGCACCTCGTTCGCGTGCTGGGGCCGCGCACAACGCC
TTCCGCTATCAAGTGA
 Primer design