SecReT4
Protein ID: 339328254
T4SS name [ID]Trb [292]
Gene symboltrbG
Locus tagCNE_BB1p04840
StrainCupriavidus necator N-1
Repliconplasmid BB1p [GenBank: NC_015727] [Browse all T4SS(s) in this replicon]
Location [Strand]499066..500058 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDF8GX38
KEGG IDcnc:CNE_BB1p04840
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.5e-66, Aligned region: 103..322
Protein Sequence: 330 a.a.     [Download]
>gi|339328254|ref|YP_004687946.1| conjugal transfer protein TrbG [Cupriavidus necator N-1]
MNQSFRFYAFVLTVAALSGCASQGKPPPSISLDKPAQAQALPEPPAPVEVVTVPEPLALPAQLKPLPEAD
TAPAAPEPADEKVRVSRANAEARIAPTREGYVNAIQVWPFTDGAVYQVYAAPRHVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGSGDALRINVLVKPIRSSLKTNLVITTSRRTYLLELTSTEKAWMASVSWDYPKDRM
LALQRQSQAAQTAAPVDTGLALEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVIG
GQGDGQLVNYRFRPPYYIVDRLFGAAELRLGGDGGDVVRIERTDGVARRN
 
Nucleotide Sequence: 993 bp     [Download]
>gi|339327781|ref|NC_015727.1|:c500058-499066 Cupriavidus necator N-1 plasmid BB1p, complete sequence
ATGAACCAGTCTTTCCGCTTTTACGCTTTCGTGCTGACCGTGGCGGCCCTGTCGGGTTGCGCCTCGCAGG
GCAAGCCGCCTCCGTCCATCTCGCTCGATAAGCCGGCGCAGGCGCAGGCGCTGCCGGAGCCACCTGCGCC
GGTGGAAGTTGTCACTGTGCCCGAGCCGCTGGCGCTGCCGGCACAGTTGAAGCCGCTACCCGAAGCGGAC
ACGGCCCCGGCGGCGCCGGAGCCTGCTGACGAGAAGGTGCGAGTCTCGCGCGCCAACGCCGAGGCTCGCA
TCGCGCCCACCCGCGAGGGCTACGTCAATGCGATTCAGGTGTGGCCTTTCACGGACGGCGCGGTCTATCA
GGTCTATGCCGCGCCGCGGCACGTGACCGTGGTTTCCTTGCAGCCGGGCGAGGAACTGGTGACTGTTGCC
GCAGGCGATACCGTGCGCTGGATCGTCGGTGACACATCCAGCGGCAGCGGCGACGCGCTGCGCATCAATG
TGCTGGTGAAGCCCATCCGTTCGAGCCTCAAGACGAACTTGGTCATCACCACCAGCCGCAGGACGTACCT
GCTGGAGCTGACCTCGACGGAAAAGGCATGGATGGCGTCGGTGTCCTGGGACTACCCGAAAGACCGGATG
CTGGCCCTGCAGCGCCAGTCGCAGGCCGCACAGACAGCCGCGCCGGTCGATACCGGCCTGGCACTGGAGA
AGATCCGTTTCCGCTACGCGGTCAGCGGCAGCAATCCGCCGTGGAAGCCGCTGCGCGCCTTCGATGACGG
CGAGAAGGTCTATATCCAGTTCCCGCCAGGCATCGCGCAAGGCGAGCTGCCGCCGCTGTTCGTGATCGGC
GGGCAGGGTGACGGGCAACTGGTGAACTACCGTTTCCGTCCACCGTACTACATCGTGGATCGGCTGTTCG
GTGCGGCCGAACTGCGCCTGGGCGGTGATGGCGGCGACGTGGTGCGGATCGAACGCACGGATGGCGTGGC
GCGGAGGAACTGA
 Primer design