SecReT4
Protein ID: 339328256
T4SS name [ID]Trb [292]
Gene symboltrbL
Locus tagCNE_BB1p04860
StrainCupriavidus necator N-1
Repliconplasmid BB1p [GenBank: NC_015727] [Browse all T4SS(s) in this replicon]
Location [Strand]500790..502163 [-]
Productconjugal transfer transmembrane protein TrbL
Component typeTrbL
UniProt IDF8GX40
KEGG IDcnc:CNE_BB1p04860
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4e-48, Aligned region: 37..264
Protein Sequence: 457 a.a.     [Download]
>gi|339328256|ref|YP_004687948.1| conjugal transfer transmembrane protein TrbL [Cupriavidus necator N-1]
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIIGNFNWLSCVVFRSFAGLGITATGSAITMENFLQPGRLAKTGIDAAAPILDQIGDMAGFPEVF
VILDPIVVLFIAWLVVILCFFVLAVQLFITLIEFKLTTLAGFVLIPFALWNKTSFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVHPDEPSIDHALVVMLASIALLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAVGTGVAIGATATGVGGAVMAGARMAPAAAKLAGSGARAATSAASSAKSAFQAGSAAARGGAKGAAAG
LGNVAKTGAQAAGRRAASGASAAGQKVADSFRAGWNGANAGAAGSGQAAAGEGADSAASAPKQEQPAWAK
RMHRRQQITHAATTAAHTLRGGDGGGSGQGPSLRPDE
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|339327781|ref|NC_015727.1|:c502163-500790 Cupriavidus necator N-1 plasmid BB1p, complete sequence
ATGAACGACGTGACCATCATCGACAGATTTCTCGATACCTTCTCGCGCTACATCGACTCGGGCTTCGGGC
TCCTGCAAGGCGAAGTGGCGTTCCTGACCGCCACACTGATCGTCATCGACATGACCATCGCCGGCCTGTA
TTGGGCCATGAGCCATGCCACCGGCCAAGGCGAGGACGTGATTGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCGGCAACTTCAACTGGTTGTCGTGCGTCGTGTTCCGGTCATTTGCGG
GGCTAGGTATCACCGCCACCGGCTCGGCCATCACGATGGAGAACTTCTTGCAGCCGGGCCGGCTGGCGAA
GACGGGCATCGACGCGGCTGCGCCGATCCTTGACCAGATCGGCGACATGGCCGGCTTCCCCGAAGTGTTC
GTGATCCTCGATCCCATCGTGGTGCTGTTCATCGCCTGGCTGGTGGTGATCCTCTGCTTCTTCGTGCTGG
CGGTACAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGCTTCGTCTTGATTCCGTT
TGCGCTCTGGAACAAGACGAGCTTCCTTGCGGAAAAGGTGCTCGGCAACGTGGTTTCGTCGGGCATCAAG
GTCTTGGTGCTGGCCGTCATCGTCGGCATCGGCTCGGGCCTGTTCGCGGAGTTTCAGGTTCATCCTGACG
AGCCTTCCATCGACCATGCGCTTGTCGTGATGCTGGCCTCGATCGCGCTGCTGGCGCTCGGCATCTTCGG
CCCCGGCATCGCCACGGGCCTTGTGTCCGGTGCGCCGCAGCTTGGCGCGGGCGCGATGGCCGGCGCTGCC
GTCGGCGCGGTCGGCACTGGCGTTGCCATTGGTGCCACCGCGACCGGCGTGGGCGGTGCCGTCATGGCGG
GCGCGCGCATGGCCCCCGCCGCCGCCAAGCTGGCCGGCAGCGGCGCACGCGCCGCCACGTCGGCGGCCAG
CAGCGCCAAGTCCGCATTCCAGGCCGGTTCCGCCGCAGCGCGCGGCGGAGCCAAGGGCGCTGCGGCGGGC
CTCGGCAATGTCGCCAAGACCGGCGCGCAAGCCGCAGGCCGCCGCGCCGCGTCCGGCGCTTCCGCTGCCG
GTCAGAAGGTGGCCGATTCCTTCCGTGCCGGATGGAACGGCGCGAATGCCGGCGCTGCCGGTTCCGGCCA
GGCCGCCGCAGGCGAAGGCGCAGACAGCGCAGCCAGCGCGCCGAAGCAAGAGCAACCCGCCTGGGCCAAG
CGGATGCACCGCCGCCAGCAGATCACCCATGCCGCGACCACCGCCGCCCACACGCTGCGCGGGGGCGACG
GCGGCGGCTCGGGGCAAGGCCCCAGCCTGCGCCCCGATGAGTGA
 Primer design