SecReT4
Protein ID: 339328257
T4SS name [ID]Trb [292]
Gene symboltrbJ
Locus tagCNE_BB1p04870
StrainCupriavidus necator N-1
Repliconplasmid BB1p [GenBank: NC_015727] [Browse all T4SS(s) in this replicon]
Location [Strand]502160..503248 [-]
Productconjugal transfer TrbJ signal peptide protein TrbJ
Component typeTrbJ
UniProt IDF8GX41
KEGG IDcnc:CNE_BB1p04870
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 362 a.a.     [Download]
>gi|339328257|ref|YP_004687949.1| conjugal transfer TrbJ signal peptide protein TrbJ [Cupriavidus necator N-1]
MKARVLSVSLAAALSVSLLAVQPASALTVFDPSNFVQNTLTAVRTLEQINNQINQLQNEAQMLLNQARNL
TKLDFNITNRLRSTLATTERLIAEAQGLAYDVQSMDATFSRLYPEQYAATISGDRMAQDARERWKNTLDG
LHTAMRMQAQVSQNLAQDESALADLVSQSQSATGALQAMQATNQLLALQAKQSIQTQQLQITQDRAASLE
LARQAAATERAREVRRRFLGTGTSYTPQSVNFYNNRREAAMRGVPVLSVSLLAVLLTACGQQPAEDLAAT
LAADPVRLKVLRARCVADRQAAGKDTCRAAAEAFRRRFFAGQAGPDEYRTLAELPPIPASFDTPDDHAPE
GDAPLAAAEDTP
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|339327781|ref|NC_015727.1|:c503248-502160 Cupriavidus necator N-1 plasmid BB1p, complete sequence
ATGAAAGCCCGTGTCCTTTCCGTTTCGCTCGCCGCCGCGCTGTCGGTGTCCCTGCTGGCCGTGCAGCCTG
CATCGGCGCTGACGGTGTTCGACCCATCCAACTTCGTGCAGAACACGCTCACCGCCGTTCGCACGCTGGA
GCAGATCAACAACCAGATCAACCAGCTCCAAAACGAAGCACAGATGCTGCTGAACCAGGCGCGCAACCTG
ACGAAGCTGGATTTCAACATCACCAACCGCCTGCGCTCGACGCTTGCCACCACCGAACGCCTGATCGCCG
AAGCGCAGGGGTTGGCCTACGACGTGCAGAGTATGGATGCCACGTTCTCGCGCCTGTACCCGGAGCAGTA
CGCCGCCACCATCAGCGGCGACCGCATGGCACAGGACGCACGCGAACGCTGGAAGAACACGCTCGACGGC
CTGCACACCGCGATGCGGATGCAGGCGCAGGTGTCGCAGAACCTGGCGCAAGACGAAAGCGCGCTAGCCG
ACCTCGTGAGCCAGAGCCAGTCGGCCACCGGCGCGCTGCAAGCGATGCAGGCAACGAACCAGCTTCTCGC
CTTGCAGGCCAAGCAGTCCATTCAGACCCAGCAGCTCCAGATCACGCAAGACCGGGCGGCCTCGCTGGAA
CTGGCTCGGCAGGCGGCGGCCACCGAGCGCGCCCGCGAAGTGCGGCGGCGCTTCCTGGGCACCGGCACGT
CGTACACGCCGCAGTCCGTCAACTTCTACAACAACCGACGGGAGGCGGCCATGCGAGGCGTTCCCGTTCT
GTCCGTTTCGCTGCTGGCCGTGCTGCTGACCGCGTGCGGCCAGCAGCCGGCCGAAGACCTGGCCGCCACC
TTGGCCGCCGATCCCGTGCGGCTCAAGGTGCTGCGCGCCCGATGCGTAGCCGACCGGCAAGCCGCAGGCA
AAGACACCTGCCGGGCCGCCGCCGAAGCCTTCCGGCGGCGGTTCTTCGCCGGCCAGGCCGGGCCGGACGA
ATACCGGACGCTGGCCGAACTGCCGCCGATTCCAGCGAGCTTCGACACGCCCGACGACCACGCGCCGGAA
GGCGATGCGCCGCTCGCCGCTGCGGAGGACACGCCATGA
 Primer design