SecReT4
Protein ID: 339328260
T4SS name [ID]Trb [292]
Gene symboltrbC
Locus tagCNE_BB1p04900
StrainCupriavidus necator N-1
Repliconplasmid BB1p [GenBank: NC_015727] [Browse all T4SS(s) in this replicon]
Location [Strand]505413..505796 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDF8GX44
KEGG IDcnc:CNE_BB1p04900
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-24, Aligned region: 30..117
Protein Sequence: 127 a.a.     [Download]
>gi|339328260|ref|YP_004687952.1| conjugal transfer protein TrbC [Cupriavidus necator N-1]
MMQMYAHAFRISVKPVSTIARLRRLAGPAHHGLLLAALLLFLTGTAQAAGSSMPWEGPLQSILESIQGPV
ARIVAVIIIIAMGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|339327781|ref|NC_015727.1|:c505796-505413 Cupriavidus necator N-1 plasmid BB1p, complete sequence
ATGATGCAGATGTACGCTCACGCTTTCCGTATTTCTGTAAAACCGGTTTCGACCATCGCACGCCTGCGGC
GGCTGGCCGGCCCCGCACACCACGGCCTGCTGCTGGCCGCGCTGCTGCTGTTCCTGACCGGCACCGCGCA
GGCGGCCGGTTCCTCGATGCCGTGGGAAGGCCCGCTGCAATCCATTCTGGAGTCGATCCAGGGGCCGGTG
GCGCGCATCGTCGCGGTCATCATCATCATCGCCATGGGCCTCGCGCTGGCCTTCGGCGACACGTCGGGCG
GCTTCCGCAAACTCATCCAGATCGTCTTCGGGCTGAGCATCGCGTTCGCGGCTTCAAGCTTCTTCCTGTC
GTTCTTCAGCTTTTCCGGCGGGGCCGTTGTATGA
 Primer design