SecReT4
Protein ID: 339487252
T4SS name [ID]Tfc [740]
Gene symbol-
Locus tagPPS_2339
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T4SS(s) in this replicon]
Location [Strand]2632218..2633537 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDF8G4S5
KEGG IDppt:PPS_2339
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 439 a.a.     [Download]
>gi|339487252|ref|YP_004701780.1| unnamed protein product [Pseudomonas putida S16]
MCTAGHAAESGYHLGDQAQVLDDRVMYTIGGGSAAGAPSSLYRPSGLGVGLSWRANMMCGNMNLSNTLQN
QLNGATQGFQQIMGNVIQNATQAVMSLPAMIIQRANPGLYELLSNGVLQGRIDFDRSKLTCQAMAAKMAD
KVDQAGWGALAQNQEMQHNLEQSDGDAVTAVKDTESNNGNNGVSWVGGQKAGGHGQAPIRVTSDVVKAGY
NLLHNRSVEDTSAVGSSCQNGAICQAWASPEEAAEWATRVLGETEVETCDDCETLRVSAGAGLTPLIQET
YTQHLEGLQRMLSGAEEPTPENLGKVSSPLLQVSRGVIEGLRDDPDQNLLARRLASETALSSVIYKAMLL
QRTLLAGSREPNVASTQPATTALNSNVETLEREIRLLQTELQVRQTLATNTASLVLDRHAGGADASRNID
QREPRPDRLQRADQGRSTP
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|339484941|ref|NC_015733.1|:c2633537-2632218 Pseudomonas putida S16 chromosome, complete genome
GTGTGCACCGCTGGCCACGCCGCCGAGAGTGGCTACCACCTGGGCGACCAGGCCCAGGTGTTGGACGACC
GCGTGATGTACACCATCGGTGGCGGATCGGCGGCAGGCGCACCCTCCTCGCTCTACCGCCCCAGCGGACT
CGGCGTGGGCCTGTCCTGGCGGGCAAACATGATGTGCGGAAACATGAACCTCTCCAACACCCTGCAGAAC
CAGCTCAACGGTGCCACCCAGGGTTTCCAGCAGATCATGGGCAACGTCATCCAGAACGCCACCCAGGCGG
TGATGTCGCTGCCGGCAATGATCATTCAGCGCGCCAACCCCGGGCTGTACGAGCTGCTGAGCAACGGCGT
GCTGCAGGGGCGCATAGACTTTGACCGTTCGAAGCTCACCTGCCAGGCGATGGCGGCGAAGATGGCTGAC
AAGGTGGACCAGGCCGGTTGGGGAGCACTGGCGCAGAACCAGGAAATGCAGCACAACCTGGAGCAGTCCG
ACGGTGATGCCGTTACGGCGGTAAAGGACACCGAATCGAACAACGGCAACAACGGCGTCAGCTGGGTCGG
CGGGCAGAAAGCCGGCGGTCATGGCCAGGCGCCGATCCGAGTGACCTCGGACGTGGTCAAAGCGGGCTAC
AACCTGCTGCACAACCGCTCGGTCGAAGACACCTCGGCCGTCGGCTCAAGTTGTCAGAATGGCGCGATCT
GCCAGGCCTGGGCGAGTCCCGAGGAGGCTGCCGAATGGGCCACTCGGGTGCTCGGCGAAACCGAGGTCGA
GACCTGTGACGATTGCGAGACGCTGCGCGTGAGCGCGGGCGCCGGTCTTACGCCACTGATCCAGGAAACT
TACACCCAGCACCTCGAGGGCTTGCAGCGCATGTTGTCAGGCGCAGAGGAGCCCACGCCAGAGAACCTCG
GCAAAGTCTCCAGCCCGTTGCTACAGGTTTCGCGCGGCGTGATTGAAGGCCTGCGTGATGACCCCGATCA
GAACCTGTTGGCCCGACGTTTGGCCAGCGAGACCGCGCTGTCGAGCGTGATCTACAAAGCGATGCTACTG
CAGCGCACGTTGCTCGCCGGTAGCCGTGAGCCCAATGTGGCGTCAACGCAGCCCGCCACCACCGCCCTCA
ACAGCAACGTCGAAACGCTGGAGCGCGAGATCCGCCTGCTGCAAACGGAGTTGCAAGTGCGCCAAACGCT
GGCCACCAATACCGCCAGCCTGGTCCTCGATCGCCACGCCGGCGGCGCCGATGCCTCACGCAATATCGAC
CAGCGCGAGCCACGCCCAGACCGCCTGCAGCGAGCGGATCAGGGAAGGAGCACGCCATGA
 Primer design