SecReT4
Protein ID: 339487259
T4SS name [ID]Tfc [740]
Gene symbol-
Locus tagPPS_2346
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T4SS(s) in this replicon]
Location [Strand]2640829..2641128 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDF8G4T2
KEGG IDppt:PPS_2346
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 6.5e-30, Aligned region: 1..93
Protein Sequence: 99 a.a.     [Download]
>gi|339487259|ref|YP_004701787.1| unnamed protein product [Pseudomonas putida S16]
MWVALIVGAVLGVVLGAPLALATASIATLPTCMFLCMALVLLGGGKLLRRAKRARPETWLYRRLQWQLAV
HWSIGTEYLILHSGPWTVRRTRRPARTTP
 
Nucleotide Sequence: 300 bp     [Download]
>gi|339484941|ref|NC_015733.1|:c2641128-2640829 Pseudomonas putida S16 chromosome, complete genome
ATGTGGGTCGCACTGATTGTCGGCGCAGTACTGGGTGTTGTCCTCGGCGCGCCGCTGGCGTTGGCCACCG
CCTCTATCGCCACCCTCCCCACCTGCATGTTCCTGTGCATGGCACTGGTATTGCTTGGCGGTGGTAAGCT
GCTGCGCCGGGCCAAACGCGCCCGCCCCGAGACCTGGTTGTATCGACGCCTGCAGTGGCAGCTGGCGGTG
CACTGGAGCATCGGCACTGAGTACCTGATCCTGCATTCTGGCCCGTGGACGGTTCGGCGCACGCGCCGGC
CTGCGAGGACCACTCCATGA
 Primer design