SecReT4
Protein ID: 339487266
T4SS name [ID]Tfc [740]
Gene symbol-
Locus tagPPS_2353
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T4SS(s) in this replicon]
Location [Strand]2645713..2646441 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDF8G4T9
KEGG IDppt:PPS_2353
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 6.6e-60, Aligned region: 45..239
Protein Sequence: 242 a.a.     [Download]
>gi|339487266|ref|YP_004701794.1| unnamed protein product [Pseudomonas putida S16]
MPTTATNPPQTQRQPRLIFGTLELCLRLLGLLFASLVFSIIVEFVGILWLWPEQGWHHSHSMWLKELGWL
SSHFRSSLLVQEPAQATAKILERLNDWVVVRSGWVQSDIQLKLLTREPSLQGQLAQAYVAGQEYLLAALF
TVCTFVVRLTVLTLATPLFLLTVLTGIVDGLMRRDLRKFGAGRESSFVYHRAKRTLLPLLISPWVIYLSL
PWSLNPNWVLIPSAALLGFMVAITATTFKKYL
 
Nucleotide Sequence: 729 bp     [Download]
>gi|339484941|ref|NC_015733.1|:c2646441-2645713 Pseudomonas putida S16 chromosome, complete genome
ATGCCTACTACCGCAACCAACCCGCCTCAGACACAACGACAACCAAGGCTGATCTTCGGCACGCTTGAGC
TGTGCCTGCGATTGCTCGGCCTGCTGTTCGCCTCCTTGGTGTTCTCCATTATTGTGGAGTTCGTGGGTAT
CCTGTGGCTCTGGCCAGAACAAGGCTGGCATCATAGCCATAGCATGTGGCTGAAAGAGCTCGGATGGCTT
AGCAGCCACTTCAGGAGCTCGCTACTCGTGCAGGAGCCGGCGCAAGCGACCGCGAAAATCCTTGAGCGCC
TCAACGATTGGGTTGTGGTCCGCTCCGGTTGGGTACAATCTGACATCCAGCTGAAACTACTCACTCGCGA
GCCGTCGTTGCAAGGACAGCTAGCTCAAGCGTATGTCGCTGGACAGGAATACCTGCTGGCGGCCCTGTTC
ACGGTCTGCACTTTCGTCGTGCGCCTGACCGTTCTCACTTTGGCCACTCCCCTGTTCTTGCTTACGGTGC
TCACCGGCATAGTCGACGGGTTGATGCGCCGCGACCTCCGCAAGTTCGGGGCGGGCAGGGAGAGCAGCTT
TGTCTATCACCGAGCCAAGCGCACATTACTACCGCTGTTGATCAGCCCTTGGGTAATCTATCTGTCGCTC
CCTTGGTCGCTGAATCCGAACTGGGTATTAATCCCCTCTGCTGCGTTGCTGGGTTTCATGGTCGCGATCA
CCGCTACAACGTTCAAAAAATATCTTTGA
 Primer design