SecReT4
Protein ID: 339487269
T4SS name [ID]Tfc [740]
Gene symbol-
Locus tagPPS_2356
StrainPseudomonas putida S16
Repliconchromosome [GenBank: NC_015733] [Browse all T4SS(s) in this replicon]
Location [Strand]2649071..2649538 [-]
Productlytic transglycosylase
Component typeTfc4
UniProt IDF8G4U2
KEGG IDppt:PPS_2356
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 155 a.a.     [Download]
>gi|339487269|ref|YP_004701797.1| unnamed protein product [Pseudomonas putida S16]
MAAAQAGIPASVLFAIAQQESGTPLRGRLIPWPWTLNVAGTSQRFATRAQACSALTVALTRHDPKRIDVG
LGQTNLGYHPERYPTACDALDPRSNLAVTADLLRGHYADVGDWVIAAGRYHRPAGGAPAARYRTQFSQHW
QRLDAATSSRGGPRS
 
Nucleotide Sequence: 468 bp     [Download]
>gi|339484941|ref|NC_015733.1|:c2649538-2649071 Pseudomonas putida S16 chromosome, complete genome
ATGGCCGCCGCCCAGGCCGGCATCCCGGCGTCGGTGCTGTTCGCCATTGCCCAGCAGGAGAGCGGCACGC
CGCTGCGTGGGCGGCTCATCCCATGGCCGTGGACCTTGAATGTGGCCGGCACGTCACAGCGTTTCGCCAC
CCGTGCCCAGGCCTGTAGCGCACTCACGGTTGCACTCACCCGGCATGATCCCAAGCGCATCGATGTCGGC
CTGGGGCAAACCAACCTGGGCTACCACCCGGAGCGTTACCCCACCGCCTGCGACGCCCTCGATCCGCGTA
GCAACCTCGCGGTCACTGCCGACCTGTTGCGCGGGCACTACGCCGACGTCGGCGACTGGGTCATCGCCGC
CGGCCGCTACCACCGGCCTGCAGGTGGGGCCCCGGCGGCGCGCTACCGCACGCAGTTCAGCCAGCACTGG
CAGCGCCTTGACGCCGCCACGTCTAGCCGTGGAGGACCACGCTCATGA
 Primer design