SecReT4
Protein ID: 339493274
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1197
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1255206..1255775 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDF8H1Y7
KEGG IDpsz:PSTAB_1197
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|339493274|ref|YP_004713567.1| hypothetical protein PSTAB_1197 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MQPSIRAVHRLALAAGLLAGSLLAAGCATTAASSAAAVPAASPTAVAPEPGFVPVARYGRYTLVELVPEP
AQRDLLQQAVEVSIPPMLDASVGDAMRHVLLRSGYRLCDAVEAATLYALPLPAAHLRLGPLMLRDALLTL
AGPAWELSVDDLTRQVCFSRHGAPTFLSANPPGTATPVPDADRPEELQP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1255206-1255775 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGCAACCATCCATCCGCGCTGTTCACCGCCTGGCCCTCGCCGCTGGCTTGCTGGCCGGCAGCCTGTTGG
CCGCCGGCTGCGCCACGACCGCCGCGTCGTCTGCGGCAGCGGTGCCGGCCGCATCGCCAACCGCCGTCGC
GCCGGAGCCGGGTTTCGTTCCGGTGGCCCGCTACGGCCGCTACACCCTGGTCGAGCTGGTGCCGGAACCT
GCGCAGCGTGATCTCTTGCAGCAGGCGGTGGAGGTCTCGATTCCGCCCATGCTCGATGCCAGCGTGGGCG
ATGCCATGCGCCATGTGCTCCTGCGCTCGGGCTACCGGCTCTGCGATGCGGTCGAAGCCGCCACGCTCTA
CGCGCTGCCGCTGCCTGCCGCACACCTGCGCCTGGGCCCGCTGATGCTGCGCGATGCCTTGCTGACCCTT
GCCGGCCCCGCCTGGGAGCTGTCGGTCGATGACTTGACCCGCCAGGTCTGCTTCAGCCGGCACGGTGCTC
CCACCTTCCTTTCCGCCAACCCGCCCGGCACCGCCACGCCCGTGCCGGACGCCGACCGGCCCGAGGAGCT
GCAGCCATGA
 Primer design