SecReT4
Protein ID: 339493276
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1199
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1256429..1257148 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDF8H1Y9
KEGG IDpsz:PSTAB_1199
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 239 a.a.     [Download]
>gi|339493276|ref|YP_004713569.1| hypothetical protein PSTAB_1199 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MNLRPLLAAVVLFATFGASAQPAPVTNSRMVPAQVQPGADAALDERQAREWGLRSEEWARYRQLMQGPLG
VYSPQLDPLTALGIEARSDEERRRYAELQVQAEAQRVGKTLAYQRAYDAAWQRLFPGQPRVSLPGAKAQG
AGNTGSGRLAVFVKADCAPCAQRVQQLQAAGTAFDLYMVGSRQDDARIRQWATQAGIDPARVRARTITLN
HDAGRWLSLGLPGDLPAVVREVNGQWQRQ
 
Nucleotide Sequence: 720 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1256429-1257148 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAACCTGCGGCCGTTGCTCGCTGCCGTCGTCCTGTTCGCCACTTTCGGCGCATCCGCCCAACCGGCCC
CGGTGACGAACTCGCGCATGGTGCCCGCTCAAGTGCAGCCGGGCGCTGATGCCGCGCTCGACGAGAGGCA
GGCGCGGGAGTGGGGGCTTCGCTCCGAGGAGTGGGCGCGTTACCGGCAACTGATGCAGGGGCCGCTCGGG
GTCTATTCGCCCCAGCTCGATCCGCTCACGGCGCTGGGCATCGAGGCCCGCAGCGACGAGGAGCGCAGGC
GCTACGCGGAGTTGCAGGTGCAGGCCGAGGCCCAGCGCGTCGGCAAGACGCTGGCCTACCAGCGCGCCTA
CGACGCGGCGTGGCAGCGCCTGTTTCCCGGCCAGCCGCGCGTGAGCCTGCCCGGCGCCAAGGCGCAGGGT
GCCGGCAACACCGGCTCCGGGCGCCTGGCGGTCTTCGTCAAGGCCGACTGCGCACCGTGCGCGCAGCGCG
TGCAGCAGTTGCAGGCGGCCGGCACGGCCTTCGATCTCTACATGGTCGGCAGCCGTCAGGACGACGCGCG
CATCCGGCAGTGGGCCACCCAGGCGGGCATCGACCCGGCCAGGGTGCGCGCCCGCACCATCACGCTCAAC
CACGATGCGGGACGCTGGCTGTCGCTCGGCCTGCCCGGCGATCTGCCGGCCGTGGTGCGCGAGGTGAACG
GCCAATGGCAGCGGCAATAG
 Primer design