SecReT4
Protein ID: 339493277
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1200
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1257133..1257753 [+]
Productlytic transglycosylase, catalytic
Component typeTfc4
UniProt IDF8H1Z0
KEGG IDpsz:PSTAB_1200
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|339493277|ref|YP_004713570.1| lytic transglycosylase, catalytic [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MAAAIGAPGREHRPSRVAIRCTSAALLLTTVGWALAALAREVPPPAYQLAAHRADVPAAVLYAVALQESG
AMLRGRLIPWPWTLNVAGSPQRYATRVEACAGLHRALAHTPANRIDAGLGQVNLGYHTHRYTQPCELLDP
YRNLAIAAEILREQHTPGEDWLLAIGRYHRPAGGAPAARYRRSVHRHLTRVLDPGVPVPTLQATTP
 
Nucleotide Sequence: 621 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1257133-1257753 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGGCAGCGGCAATAGGTGCTCCGGGCCGGGAGCACCGGCCGTCCCGCGTCGCCATCCGCTGCACCAGCG
CCGCGCTGCTGCTCACCACCGTCGGCTGGGCGCTGGCCGCCCTGGCGCGGGAAGTGCCGCCGCCGGCCTA
TCAACTGGCGGCGCATCGTGCAGACGTGCCGGCGGCCGTGCTGTACGCGGTGGCCTTGCAGGAGAGCGGC
GCCATGCTGCGCGGGCGCCTGATCCCCTGGCCGTGGACGCTCAACGTCGCCGGCTCGCCACAGCGCTACG
CCACCCGCGTCGAGGCCTGCGCGGGGCTGCACCGTGCGCTCGCCCACACGCCGGCCAATCGCATCGACGC
CGGCCTCGGCCAGGTCAATCTCGGCTACCACACGCATCGCTACACGCAGCCCTGCGAGCTGCTGGACCCG
TACCGCAACCTCGCCATCGCTGCGGAAATCCTGCGCGAACAGCACACGCCGGGCGAGGACTGGCTGCTTG
CCATCGGCCGCTACCACCGGCCCGCCGGCGGGGCACCCGCGGCGCGATACCGGCGCAGTGTGCATCGGCA
CCTGACCCGCGTACTCGACCCCGGCGTTCCCGTTCCAACTCTCCAGGCCACCACGCCATGA
 Primer design