SecReT4
Protein ID: 339493278
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1201
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1257750..1258283 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDF8H1Z1
KEGG IDpsz:PSTAB_1201
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 9.1e-56, Aligned region: 30..176
Protein Sequence: 177 a.a.     [Download]
>gi|339493278|ref|YP_004713571.1| hypothetical protein PSTAB_1201 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MNHTVLIAAIGLLSTTTIFAQTVSGPLIVVEDRGGDSALPYYQSLNPQPDQATPPAPMPTPRAGNTADAE
AAMLPVRSTQLSPGEVQRRVIRAPGLTALFLIGDDERSRAWLRQRQAALRELQAVGLVVNVESMAALTAL
RRLAPGLILSPASGDDLAQRLGLRHYPVLITATGVEQ
 
Nucleotide Sequence: 534 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1257750-1258283 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAACCACACCGTCCTCATCGCCGCCATCGGGCTGCTGTCCACGACCACCATCTTCGCCCAGACCGTCT
CCGGGCCGCTGATCGTCGTCGAAGACCGCGGCGGCGACTCCGCGCTGCCGTACTACCAGTCGCTGAATCC
TCAGCCGGATCAGGCCACGCCGCCGGCCCCGATGCCGACCCCTCGCGCGGGCAACACGGCCGACGCCGAA
GCCGCCATGCTGCCGGTGCGCTCGACGCAACTGTCGCCGGGCGAGGTGCAGCGCCGCGTCATCCGGGCGC
CGGGCCTGACGGCGCTGTTCCTGATCGGCGACGACGAGCGTTCGCGCGCCTGGCTGCGGCAGCGGCAGGC
GGCGCTGCGAGAGCTGCAGGCCGTGGGCCTGGTGGTCAACGTGGAGTCGATGGCTGCGCTGACGGCGCTG
CGCAGGCTGGCGCCCGGCCTGATCCTGTCGCCGGCCTCCGGCGATGATCTGGCCCAGCGCCTGGGCCTGC
GCCACTACCCGGTGCTCATCACGGCCACCGGTGTCGAGCAGTAG
 Primer design