SecReT4
Protein ID: 339493279
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1202
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1258292..1260448 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDF8H1Z2
KEGG IDpsz:PSTAB_1202
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 2e-14, Aligned region: 506..636
TrwB_AAD_bind [PF10412], Evalue: 4.6e-09, Aligned region: 509..646
AAA_10 [PF12846], Evalue: 9.4e-09, Aligned region: 190..583
Protein Sequence: 718 a.a.     [Download]
>gi|339493279|ref|YP_004713572.1| hypothetical protein PSTAB_1202 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MAQPHAVEVLLRPAVELYTVAVCTGAAILCLVAPWSLALNPLLGLGSALAFLTFGAIRLRDAWAILRYRR
NIRRLPRYVMTSRDVPVSQQRLFVGQGFRWEQRHTHRLMQTYRPEFRRYVEPTAIYRAARRLEERLEFAP
FPVSTLARALAWDSPLNPARPLPSVGGLPRLHGIEPAEVDVTLPLGERVGHTLVLGTTRVGKTRLAELFI
TQDIRRKVRGEHEVVIVFDPKGDADLLKRMYVEAKRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVA
TRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYLLIQRHVINIDALFIEYAQHYFAKNEPKAW
EVIVQLEAKLNEKNIPRNMIGREKRVVALEQYLSQVRIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEK
LTTGKIAQLLAPNYSDLSDPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYKF
GVDDGLPGAAAGAKIPINVHADEFNELMGDEFIPMVNKGGGAGVQVTAYTQTLSDIEARIGNRAKAGQVV
GNFNNLFMLRVRETATAELLTRQLPKVEVYATALMSGATDSSDPHGNTAFTSNTQDRISSNSVPLIEPAH
VVALPKGQCFALTEGGNLWKVRMPLPAPDPDEAMPKDLQELAGYMRQHYVEAGDWWENQGIPGLQDKALP
DDLLDDFKQMAAAEEAEA
 
Nucleotide Sequence: 2157 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1258292-1260448 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGGCCCAACCGCATGCGGTCGAGGTCTTGCTGCGGCCAGCGGTGGAGCTTTATACCGTGGCGGTCTGCA
CCGGCGCCGCGATTCTGTGCCTGGTGGCACCGTGGTCGCTCGCGCTGAACCCGCTGCTCGGCCTGGGCTC
GGCGCTGGCCTTCCTGACCTTCGGCGCGATTCGCCTGCGCGATGCCTGGGCGATCCTGCGCTATCGCCGC
AACATCCGCCGCCTGCCGCGCTACGTGATGACCAGCCGCGACGTGCCGGTGAGTCAGCAACGGCTGTTCG
TCGGCCAGGGCTTTCGCTGGGAACAGCGGCACACGCACCGGCTGATGCAGACCTATCGGCCGGAGTTCCG
CCGCTACGTCGAGCCGACGGCGATCTACCGGGCCGCCCGGCGGCTGGAGGAGCGGCTTGAGTTCGCGCCG
TTTCCCGTCTCGACGCTGGCGCGCGCGTTGGCCTGGGACAGCCCGCTCAACCCGGCGCGACCACTGCCGT
CGGTCGGCGGACTGCCACGCCTGCATGGCATCGAACCTGCCGAGGTCGACGTCACCCTGCCGCTGGGCGA
GCGCGTCGGCCACACCCTGGTGCTGGGCACCACGCGCGTGGGCAAGACGCGGCTGGCCGAGCTGTTCATC
ACCCAGGACATCCGCCGCAAGGTCCGCGGCGAGCACGAGGTGGTGATCGTCTTCGACCCCAAGGGCGATG
CGGACCTGTTGAAGCGCATGTACGTCGAGGCCAAGCGCGCCGGGCGCGAAGGCGAGTTCTACGTCTTCCA
TCTGGGCTGGCCGGACATCTCGGCGCGCTACAACGCCGTGGGCCGGTTCGGGCGGATCTCCGAGGTGGCC
ACGCGGATCGCCGGGCAGCTCTCCGGCGAAGGCAACAGCGCCGCGTTCCGCGAATTCGCCTGGCGCTTCG
TCAACATCATCGCGCGCGCCCTGGTCGAGCTGGGGCAGCGGCCGGACTACCTGCTGATCCAGCGCCACGT
CATCAACATCGACGCGCTGTTCATCGAGTACGCCCAGCACTACTTCGCCAAGAACGAGCCGAAGGCCTGG
GAGGTCATCGTCCAGCTCGAAGCGAAGCTGAACGAGAAGAACATCCCGCGCAACATGATCGGGCGCGAGA
AGCGCGTGGTGGCCCTCGAACAGTACCTGTCCCAAGTGCGCATCTATGACCCGGTGCTCGACGGCCTGCG
CAGCGCCGTGCGCTACGACCGGACCTACTTCGACAAGATCGTCGCTTCGCTGCTGCCGCTGCTGGAGAAG
CTCACCACCGGCAAGATCGCGCAACTGCTCGCACCGAACTATTCCGACCTGTCCGACCCGCGGCCGATCT
TCGACTGGATGCAGGTCATCCGCAAACGCGCGGTGGTCTACGTGGGGCTGGATGCGCTGTCCGACGCCGA
AGTCGCGGCGGCGGTGGGCAACTCGATGTTCAGCGATCTGGTCTCGGTCGCCGGCCACATCTACAAGTTC
GGCGTCGACGACGGGCTGCCCGGCGCCGCGGCGGGCGCCAAGATTCCGATCAACGTCCACGCCGACGAAT
TCAACGAACTCATGGGCGACGAGTTCATTCCGATGGTCAACAAGGGCGGCGGTGCCGGCGTGCAGGTGAC
GGCCTACACGCAGACCTTGAGCGACATCGAGGCCCGCATCGGCAATCGTGCCAAGGCCGGCCAGGTGGTC
GGCAACTTCAACAACCTGTTCATGCTGCGCGTGCGCGAGACCGCCACCGCCGAGCTGCTGACGCGACAAC
TGCCCAAGGTCGAGGTGTACGCCACGGCGCTGATGAGCGGCGCCACCGACAGCTCCGATCCGCACGGCAA
TACCGCGTTCACGTCCAACACCCAGGACCGCATCAGCAGCAACAGCGTGCCGTTGATCGAGCCGGCGCAT
GTGGTGGCGCTGCCCAAGGGGCAGTGCTTCGCGCTGACCGAGGGCGGCAACCTCTGGAAAGTCCGCATGC
CGCTGCCTGCGCCCGACCCCGACGAAGCCATGCCGAAGGATCTGCAGGAGCTGGCCGGCTACATGCGGCA
GCACTACGTCGAGGCAGGAGACTGGTGGGAGAACCAAGGCATCCCCGGCCTGCAGGACAAGGCGCTGCCC
GACGACCTGCTGGACGACTTCAAGCAGATGGCCGCGGCTGAAGAGGCCGAAGCATGA
 Primer design