SecReT4
Protein ID: 339493280
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1203
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1260445..1261194 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDF8H1Z3
KEGG IDpsz:PSTAB_1203
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3e-72, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|339493280|ref|YP_004713573.1| hypothetical protein PSTAB_1203 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MSDPAVAAQRQQQRQQGLIASLVTLPFRFFGVLCGALLLCILIECVGMHFFWPEQGWRHAQGMLHYELDQ
LSTHFTRSALVQEPGRTAHRLVEQGYDWLFVKSGLLDWIRDASAQASAGSHRPTKDFRYYIGLVYVNVES
YLIAAAYTTLVFLVRLLVLCLTLPLFLMAAFVGLVDGLVRRDIRRFGAGRESGFIYHRARASLIPLAVLP
WVTYLALPVSVNPLLILLPSAALLGVAVCIAAATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1260445-1261194 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAGCGATCCGGCCGTCGCGGCACAGCGCCAGCAGCAACGACAGCAAGGCCTGATCGCCAGCCTGGTCA
CGCTGCCGTTCCGCTTCTTCGGCGTGCTGTGCGGCGCGCTGCTGCTGTGCATCCTGATCGAATGCGTCGG
CATGCACTTCTTCTGGCCCGAGCAGGGCTGGCGCCACGCGCAGGGCATGCTGCACTACGAGCTGGATCAG
CTTTCCACGCATTTCACCCGCAGCGCGCTGGTGCAGGAGCCGGGGCGCACCGCGCACCGGCTGGTCGAGC
AGGGCTACGACTGGCTGTTCGTGAAAAGCGGTCTGCTGGACTGGATACGCGACGCCTCGGCGCAGGCCAG
CGCCGGCAGCCATCGTCCGACCAAGGATTTCCGCTACTACATCGGCTTGGTCTATGTGAACGTGGAGAGC
TACCTGATCGCGGCGGCCTATACGACGCTGGTCTTCCTCGTGCGGCTGCTGGTGCTGTGCCTGACCCTGC
CGCTGTTCCTGATGGCCGCCTTCGTCGGGCTGGTCGACGGCCTGGTGCGCCGGGACATCCGCCGCTTCGG
CGCGGGACGCGAGTCGGGGTTCATCTATCACCGCGCCAGGGCCAGCCTGATCCCGCTGGCCGTGCTGCCG
TGGGTGACTTACCTGGCACTGCCGGTCAGCGTGAACCCGCTGCTGATCCTGCTGCCCAGTGCCGCATTGC
TCGGCGTGGCGGTGTGCATTGCGGCGGCGACGTTCAAGAAGTATCTGTAG
 Primer design