SecReT4
Protein ID: 339493288
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1211
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1275202..1275573 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDF8H201
KEGG IDpsz:PSTAB_1211
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.3e-30, Aligned region: 30..108
Protein Sequence: 123 a.a.     [Download]
>gi|339493288|ref|YP_004713581.1| hypothetical protein PSTAB_1211 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MGQTNRRTSAWPALAVVLAVSFSALQPAAAADSLASEREQLAALARQLDLIDRLAEHAANTAPQERARYH
FDYAQLRADLKRVRAGLEDYLVPQRAQPRDPVPLAGDYVRRDRADDDDEEPSP
 
Nucleotide Sequence: 372 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1275202-1275573 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGGGACAGACCAACCGCCGCACATCCGCATGGCCTGCGCTTGCCGTGGTGTTGGCTGTGTCGTTCTCGG
CGCTGCAGCCTGCCGCCGCTGCCGACAGCCTCGCCTCGGAGCGTGAGCAGCTCGCCGCGCTTGCCCGCCA
ACTCGACCTGATCGACCGCCTCGCCGAGCACGCCGCCAATACCGCTCCGCAGGAGCGCGCCCGCTACCAC
TTCGACTACGCCCAACTGCGTGCCGACCTGAAGCGCGTTCGCGCCGGCCTGGAGGACTACCTCGTGCCCC
AGCGCGCCCAGCCGCGCGATCCCGTCCCGCTGGCCGGCGATTACGTCCGCCGTGACCGCGCCGACGACGA
CGACGAGGAGCCATCGCCATGA
 Primer design