SecReT4
Protein ID: 339493291
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1214
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1276213..1276623 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDF8H204
KEGG IDpsz:PSTAB_1214
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.2e-49, Aligned region: 12..133
Protein Sequence: 136 a.a.     [Download]
>gi|339493291|ref|YP_004713584.1| hypothetical protein PSTAB_1214 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MAVPSETPQDTLVSFLPHRLNRQPVVVRGLTADELWICAGLSAAAGFALGLPLAWLTHSIAMVPTLIVAG
IALGVFVGGGFLRAQKRGRPDTWLYRQLQWRLALRHPALAALLGGQRLITRSGYWTTRRNANRGAP
 
Nucleotide Sequence: 411 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1276213-1276623 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGGCCGTCCCCTCGGAGACCCCGCAAGACACGCTGGTGAGCTTCCTGCCGCACCGGCTGAATCGCCAGC
CGGTGGTCGTGCGCGGGCTGACCGCCGACGAGTTGTGGATCTGCGCCGGCCTGTCGGCCGCAGCCGGATT
CGCACTCGGCCTGCCGCTGGCCTGGCTCACGCACAGCATCGCCATGGTGCCGACGCTGATCGTCGCCGGC
ATCGCGCTGGGCGTCTTCGTCGGCGGTGGTTTTCTGCGCGCACAGAAGCGCGGCCGGCCCGACACCTGGC
TCTACCGACAGCTCCAGTGGCGGCTGGCATTGCGGCACCCGGCGCTGGCAGCGCTCCTGGGCGGGCAGCG
CCTCATCACCCGCTCGGGCTACTGGACGACCCGGCGCAACGCCAATCGAGGTGCGCCATGA
 Primer design