SecReT4
Protein ID: 339493292
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1215
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1276620..1277312 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDF8H205
KEGG IDpsz:PSTAB_1215
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 3.9e-91, Aligned region: 5..206
Protein Sequence: 230 a.a.     [Download]
>gi|339493292|ref|YP_004713585.1| hypothetical protein PSTAB_1215 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MSRFRNEVAHLQAHVKTLRLGAGALFAVALLLGFGWWSAPKSLTIHVPPDLRSGSMRKWWDVPPESVYAF
SFYIWQQVQRWPTNGEEDYPRNLRALSAYLTPSCRAFLQQDYEYRRASGELRQRVRGIYEIPGRGYGDDP
ATRVKVLSDRDWIVTLDVSADEYYGSEQVKRALVRYPIKVVRLDIDPERNPFGLALDCYASAPQRIETPP
TPTQAGAPANASGHLQGDSP
 
Nucleotide Sequence: 693 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1276620-1277312 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAGCCGTTTCAGGAACGAGGTTGCGCACCTGCAGGCGCACGTGAAGACGCTGCGTCTGGGGGCCGGCG
CGTTGTTCGCGGTGGCGCTGCTGCTCGGCTTCGGCTGGTGGAGTGCGCCGAAGAGTCTGACCATCCATGT
GCCGCCGGACTTGCGCTCGGGCAGCATGCGCAAGTGGTGGGACGTGCCGCCCGAGAGCGTGTATGCCTTC
TCGTTCTACATCTGGCAGCAGGTACAGCGTTGGCCCACGAACGGCGAAGAAGACTATCCGCGCAACCTGC
GCGCGCTGTCGGCCTACCTGACGCCGAGCTGCCGGGCCTTCCTGCAACAGGACTACGAGTACCGGCGCGC
CAGTGGCGAGCTGCGTCAGCGCGTGCGCGGCATCTACGAGATTCCCGGCCGCGGCTACGGCGATGATCCG
GCCACGCGCGTCAAGGTGCTCTCCGACCGCGATTGGATCGTCACGCTCGACGTGAGCGCGGACGAATACT
ACGGCTCCGAGCAGGTCAAGCGTGCCCTGGTGCGCTACCCCATCAAGGTCGTCCGGCTGGACATCGACCC
CGAGCGCAACCCCTTTGGCCTGGCGCTGGACTGCTACGCCAGCGCGCCCCAGCGCATCGAAACGCCGCCG
ACGCCGACCCAGGCCGGCGCGCCCGCCAACGCCTCCGGCCACCTGCAGGGAGACTCCCCATGA
 Primer design