SecReT4
Protein ID: 339493293
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1216
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1277309..1278223 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDF8H206
KEGG IDpsz:PSTAB_1216
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 6.2e-126, Aligned region: 8..284
Protein Sequence: 304 a.a.     [Download]
>gi|339493293|ref|YP_004713586.1| hypothetical protein PSTAB_1216 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MKPVALSALAGVLLILGVVPASQAVEILRWERLPLPVPLVVGQERVVFIDRNVRVGVPASVGDHLRVQSA
GGAIYLRASEPIPPTRLQLQDVESGALILLDIAAEPAKDGQAPLEPVRIVEAEAPAKRYGGGAASGADEQ
ADAPADKSVPRRETPVSVVLTRHAAQNLYAPLRTVEPVAGIGRVNLRRGLALDTLLPTLPVQARALAAWR
LEDQWVTAVRLTNTAARWLDLDPRALQGNFVAATFQHPNLGPAGTPSDTTVLYLVTRGHGLAESLLPALS
PIDATANLPPAAAAGSTGGARDEK
 
Nucleotide Sequence: 915 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1277309-1278223 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAAGCCCGTTGCCTTGTCGGCCCTGGCCGGCGTCCTGCTGATCCTCGGTGTCGTGCCGGCCAGCCAGG
CCGTGGAAATCCTGCGCTGGGAGCGGCTGCCCCTGCCGGTGCCGCTGGTGGTCGGCCAGGAGCGCGTGGT
CTTCATCGACCGCAATGTGCGCGTCGGCGTACCGGCCAGCGTCGGCGACCATCTGCGCGTGCAGAGTGCG
GGCGGCGCGATCTACCTGCGGGCGAGCGAGCCGATTCCGCCCACGCGGCTGCAACTGCAGGACGTGGAAT
CCGGCGCGCTGATCCTGCTCGACATCGCCGCCGAGCCGGCGAAGGACGGCCAGGCGCCGCTGGAGCCGGT
GCGCATCGTGGAAGCGGAGGCCCCCGCGAAGCGCTACGGCGGCGGTGCAGCAAGTGGCGCGGACGAGCAG
GCCGATGCGCCCGCAGACAAATCCGTTCCCCGGCGCGAAACGCCGGTATCGGTCGTGTTGACGCGCCATG
CCGCACAGAACCTGTACGCGCCGCTGCGCACCGTCGAGCCAGTCGCCGGCATCGGGCGCGTGAACCTGCG
CCGCGGCCTCGCGCTGGACACCTTGCTGCCGACGCTGCCGGTGCAGGCGCGGGCACTGGCCGCGTGGCGC
CTGGAAGACCAGTGGGTGACGGCCGTGCGACTCACCAACACCGCCGCGCGTTGGCTCGACCTCGACCCGC
GCGCCCTGCAGGGGAACTTCGTGGCGGCGACCTTCCAGCATCCGAACCTGGGTCCGGCCGGCACTCCGTC
CGACACCACGGTGCTCTACCTGGTCACGCGCGGCCACGGCCTGGCCGAGTCGCTGCTGCCGGCGCTGAGC
CCGATCGATGCCACCGCGAACCTGCCGCCGGCCGCCGCGGCCGGCTCGACCGGAGGCGCGCGCGATGAAA
AGTAA
 Primer design