SecReT4
Protein ID: 339493294
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1217
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1278213..1279646 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDF8H207
KEGG IDpsz:PSTAB_1217
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 477 a.a.     [Download]
>gi|339493294|ref|YP_004713587.1| hypothetical protein PSTAB_1217 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MKSNPLLKWLLIPMALLLVFVGVKLFSGAPGGQPAPKGAASTLTPEEMKALGIAGDTPRDTVATLVAQVK
QLRTELQSALGDNKQHKAENERLRARESAIDQRIQSALEGERNRLEQERTQVASDRQQTQGLLQDLQRQL
DGLAGKGGPSDLPVGLGLEEGDGKRFNRGVGGTQWVEPDDAKVDAKNASKEPSFPLSFGPAQKSLSAAAE
SVADVGSRAVGASTKAVYTVPSNSTLMGSIAMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANGIDIPDV
AGAVVSGTASGDWTLSCVRGQIRSVTFVFQDGTIRTVPEDSGKGGSSGGNSGHNGASIQGGLGWISDPYG
IPCVSGERRSNAQQYLGSQALITAAGAGAASLIKSDNGSVAVVANSNGSLGTVGISGNEAMGRILAGGVR
DMADWVNKLYGQAFAAVYVQPGAKVAVHLEQPLDIDYDAKGRRVHHRTGEAHASDLD
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1278213-1279646 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAAAAGTAATCCGCTGCTCAAGTGGCTGCTGATCCCGATGGCGCTGCTGCTGGTGTTCGTCGGCGTCA
AACTGTTCTCCGGCGCCCCCGGCGGCCAGCCCGCCCCCAAGGGCGCGGCCAGTACGCTCACGCCCGAGGA
GATGAAAGCCCTGGGCATCGCCGGCGACACGCCGCGCGATACCGTCGCCACGCTGGTGGCCCAGGTGAAG
CAGTTGCGCACCGAGCTGCAGAGCGCGCTCGGCGACAACAAGCAGCACAAGGCCGAGAACGAGCGCCTGC
GTGCCCGGGAAAGCGCGATCGACCAGCGCATCCAGAGCGCGCTGGAAGGCGAACGCAACCGCCTGGAGCA
GGAGCGCACCCAGGTGGCCAGCGACAGGCAGCAGACCCAGGGGCTGCTGCAGGATCTGCAGCGGCAACTG
GACGGCCTTGCCGGCAAGGGTGGCCCGTCCGACCTGCCCGTCGGGCTGGGGCTGGAAGAGGGTGACGGCA
AGCGCTTCAACCGCGGCGTCGGTGGTACGCAGTGGGTCGAGCCCGACGATGCCAAGGTCGACGCCAAGAA
CGCCAGCAAGGAGCCGAGCTTTCCCCTGAGCTTCGGGCCGGCCCAGAAAAGCCTGTCGGCCGCAGCGGAA
TCCGTCGCCGACGTCGGCAGCCGCGCGGTGGGTGCCTCCACGAAGGCGGTCTACACCGTGCCGTCGAACT
CGACGCTCATGGGGTCGATTGCCATGACGGCGCTGATCGGGCGCGTGCCGATCGATGGAACGGTCAACGA
CCCGTACCCGTTCAAGGTGCTGATCGGCCCGGATAACCTCACGGCCAACGGCATCGACATCCCCGACGTG
GCCGGCGCCGTGGTCAGCGGCACGGCCTCGGGCGACTGGACGCTCTCGTGCGTGCGCGGGCAAATCCGCT
CGGTCACGTTCGTGTTCCAGGACGGCACCATCCGCACGGTGCCGGAGGACAGCGGCAAGGGCGGCAGCAG
CGGCGGCAACTCGGGTCACAACGGCGCCAGCATCCAGGGCGGCCTGGGCTGGATCAGCGACCCCTACGGC
ATTCCCTGCGTCAGCGGCGAGCGGCGCAGCAACGCCCAGCAGTACCTGGGCAGTCAGGCGCTCATCACCG
CGGCCGGCGCCGGCGCGGCCTCGCTCATCAAGTCCGACAACGGCAGCGTGGCCGTGGTCGCCAACAGCAA
CGGCTCGCTGGGCACCGTCGGCATCAGCGGCAACGAAGCGATGGGCCGCATCCTCGCGGGCGGCGTGCGC
GACATGGCCGATTGGGTCAACAAGCTCTACGGCCAGGCCTTCGCGGCGGTCTACGTGCAGCCCGGCGCCA
AGGTGGCCGTGCATCTGGAGCAGCCGCTCGACATCGACTACGACGCCAAGGGGCGTCGGGTTCACCACCG
CACCGGAGAAGCCCATGCCTCGGATCTGGATTGA
 Primer design