SecReT4
Protein ID: 339493295
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1218
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1279657..1280061 [+]
Producthypothetical protein
Component typeTfc15
UniProt IDF8H208
KEGG IDpsz:PSTAB_1218
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|339493295|ref|YP_004713588.1| hypothetical protein PSTAB_1218 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MLLAATLLGGCATSKEKLLPHGDSTMLDIWHRETGGSAGGGQAARQLLDARQGLRRPLAEADVQAAPGVQ
ARYTRTAQNEIYRQFHRLPNPDLVMYVFPHLAGTDPVPVPGYSTVFPLYQRVQYAMPGERVEDY
 
Nucleotide Sequence: 405 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1279657-1280061 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
GTGCTGCTGGCGGCCACCCTGCTCGGCGGCTGCGCTACCAGCAAGGAGAAGCTGCTGCCGCACGGCGACA
GCACCATGCTCGACATCTGGCATCGGGAGACCGGCGGCAGCGCGGGCGGCGGCCAGGCCGCGCGGCAACT
GCTCGATGCGCGCCAGGGCCTGCGCCGGCCGCTGGCCGAGGCCGATGTGCAGGCGGCGCCCGGCGTGCAG
GCGCGCTACACCCGCACCGCGCAGAACGAGATTTACCGCCAGTTCCACCGCCTGCCGAACCCCGACCTGG
TGATGTACGTGTTCCCGCACCTGGCGGGCACCGACCCGGTTCCGGTGCCCGGCTACAGCACGGTGTTCCC
GCTCTACCAGCGCGTGCAGTACGCGATGCCGGGCGAGCGCGTGGAGGACTACTGA
 Primer design