SecReT4
Protein ID: 339493296
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1219
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1280061..1282949 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDF8H209
KEGG IDpsz:PSTAB_1219
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6e-72, Aligned region: 65..340
AAA_10 [PF12846], Evalue: 4.8e-45, Aligned region: 535..872
Protein Sequence: 962 a.a.     [Download]
>gi|339493296|ref|YP_004713589.1| hypothetical protein PSTAB_1219 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MAWSLSWSRKGDASPADAVDATDDAWARHVAALVAQGVAEPGSALGRGRRRPATQADHDALYGVAPSFAD
LLPWVEYLPGSKCMLLEDGQSVAAFFELAPVGTEGREMAWLWQARDALENALQDSFDELDDNPWVVQLYA
QDEADWDNYLRSLANYLQPRAQGSAFSDFYLRFFAHHLRAIAKPGGLFEDTTVTRLPWRGQVRRVRMVVY
RRTSAAPASRRGQSPEQALTTICDRLVGGLANAGVKARRLGAADIHAWLLRWFNPNPTLLGATAEDRERF
YALTRYPEEREEGEIELASGTDFAQRLFFGQPRSDVPNGLWFFDGMPHRVIVMDRLRTPPVTGHLTGETR
KGGDAMNALFDQMPEDTVMCLTLVATPQDVLEAHLNHLARKAVGETLASEQTRQDVQQARGLIGSAHKLY
RGALAFYLRGRDLAQLDARGLQLVNVMLNAGLQPVREEDEVAPLNSYLRWLPCVFDPAADKRQWYTQLMF
AQHAANLAPVWGRSQGTGHPGITFFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNILNQVT
AIYRPRLFIVEAGNSFGLFGDFAARLGLTVHRVKLSPGAGVSLAPFADAWRLVDTPSQVQTLDADALDED
QTDAGMAVEGDEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAQHCVADERTVLTRDV
RDALRERARDATLPEMRRARLLEMADAMDMFCQGVDGEMFDRSGTPWPEADITIVDLATFAREGYNAQLS
IAYISLINTVNNIAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNLDDLPK
AAEPMLNMIEWWICLSMPPDEVEKIARFRELNASQKALMLSARKEAGKFSEGVILSKSMEVLFRAVPPSL
YLAMAMTEPEEKAERFQLMQQHGISELDAAFRVAEKIDRARGIEPLALDTLA
 
Nucleotide Sequence: 2889 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1280061-1282949 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGGCCTGGTCGCTGTCGTGGTCACGCAAGGGCGACGCATCGCCTGCTGACGCCGTGGATGCGACCGATG
ATGCCTGGGCACGGCACGTGGCGGCCTTGGTGGCACAGGGTGTCGCCGAGCCGGGCAGCGCGCTCGGCCG
GGGCCGGCGCAGGCCGGCCACCCAGGCCGACCACGATGCGCTCTATGGCGTCGCGCCGTCGTTCGCGGAC
TTGCTGCCCTGGGTCGAGTACCTGCCCGGCAGCAAGTGCATGTTGCTGGAAGATGGCCAGTCGGTGGCGG
CCTTCTTCGAGCTGGCGCCGGTCGGCACCGAGGGCCGCGAGATGGCCTGGCTATGGCAGGCGCGCGATGC
GCTGGAGAACGCCCTGCAGGACTCCTTCGACGAGTTGGACGACAACCCCTGGGTGGTGCAGCTCTACGCC
CAGGACGAGGCCGACTGGGACAACTATCTGCGCTCCCTGGCGAACTATCTGCAGCCGCGTGCGCAGGGCA
GTGCGTTCAGCGACTTCTACCTGCGCTTCTTCGCCCATCATCTGCGGGCCATCGCCAAGCCGGGTGGCTT
GTTCGAGGACACCACGGTGACGCGCCTGCCGTGGCGCGGTCAGGTCCGGCGCGTGCGCATGGTGGTCTAC
CGCCGCACGTCCGCGGCCCCGGCTTCGCGGCGCGGCCAGTCGCCCGAGCAGGCGCTGACGACGATCTGCG
ACCGCCTCGTCGGCGGGCTGGCGAATGCCGGCGTGAAAGCCCGGCGTCTCGGCGCGGCGGACATCCACGC
CTGGCTGCTGCGCTGGTTCAACCCGAATCCGACTTTGCTCGGCGCCACTGCCGAAGATCGGGAACGCTTC
TACGCGCTGACCCGCTACCCGGAAGAGCGGGAGGAGGGCGAGATCGAACTCGCCAGCGGCACCGACTTCG
CGCAGCGCCTGTTCTTCGGCCAGCCACGTTCGGACGTGCCCAACGGCCTGTGGTTCTTCGACGGCATGCC
GCATCGGGTGATCGTGATGGATCGCCTGCGCACGCCACCCGTGACCGGCCATCTGACGGGCGAGACGCGC
AAAGGCGGCGATGCCATGAACGCGCTGTTCGATCAGATGCCCGAGGACACGGTGATGTGCCTGACGCTGG
TCGCCACGCCCCAGGACGTTCTGGAGGCGCACCTCAACCACCTCGCCAGGAAAGCCGTCGGCGAGACCCT
GGCCTCGGAGCAGACCCGGCAGGACGTGCAGCAGGCGCGCGGCCTGATCGGCAGCGCGCACAAGCTCTAC
CGCGGCGCGCTGGCGTTCTACCTGCGCGGCCGCGACCTGGCCCAGCTCGATGCGCGCGGCCTGCAGCTCG
TCAACGTGATGCTCAACGCCGGTCTGCAACCGGTGCGCGAAGAGGACGAGGTGGCGCCGCTGAACAGCTA
TCTGCGCTGGCTGCCGTGCGTGTTCGATCCGGCGGCCGACAAGCGCCAGTGGTACACCCAGCTCATGTTC
GCGCAGCACGCGGCGAACCTGGCGCCGGTCTGGGGCCGCAGTCAGGGCACGGGGCATCCGGGCATCACGT
TCTTCAACCGCGGCGGCGGCCCGATCACCTTCGATCCGTTGAACCGCCTCGACCGGCAGATGAACGCGCA
TCTGTTCCTGTTCGGCCCCACGGGTTCGGGCAAGAGCGCGACGCTCAACAACATCCTGAATCAGGTGACG
GCGATCTATCGGCCGCGCCTGTTCATCGTCGAGGCGGGCAACAGCTTCGGCCTGTTCGGCGACTTCGCGG
CACGGCTGGGCCTCACCGTGCATCGGGTGAAGCTCTCGCCGGGCGCGGGCGTCAGTCTGGCGCCGTTCGC
CGACGCCTGGCGCCTGGTCGATACGCCGAGCCAGGTACAGACGCTGGACGCCGATGCGCTCGACGAAGAC
CAGACCGATGCCGGCATGGCCGTGGAAGGCGACGAGCAGCGCGACGTGCTCGGCGAGCTGGAAATCACTG
CACGACTGATGATCACCGGCGGCGAGGACAAGGAAGAAGCGCGCATGACCCGCGCCGACCGCAGCCTGAT
CCGCCAGTGCATTCTCGATGCGGCACAGCATTGCGTGGCGGACGAACGCACGGTGCTCACACGCGATGTG
CGCGACGCGCTGCGCGAGCGCGCCCGCGACGCCACGCTGCCGGAGATGCGGCGCGCACGGCTGCTGGAGA
TGGCCGACGCCATGGATATGTTCTGCCAGGGCGTGGACGGCGAGATGTTCGACCGGTCCGGCACGCCGTG
GCCCGAGGCGGACATCACCATCGTGGACCTGGCCACCTTCGCGCGCGAGGGCTACAACGCCCAACTCTCG
ATTGCCTACATCTCGCTCATCAACACGGTCAACAACATCGCCGAGCGCGACCAGTTCCTGGGCCGCCCGA
TCATCAACGTGACGGACGAAGGCCACATCATCACGAAGAACCCGCTGCTCGCGCCCTACGTGGTCAAGAT
CACCAAGATGTGGCGCAAGCTCGGCGCCTGGTTCTGGCTCGCCACGCAGAACCTGGACGACCTGCCGAAA
GCGGCCGAGCCCATGCTCAACATGATCGAGTGGTGGATCTGCCTGTCGATGCCACCCGATGAAGTCGAGA
AGATCGCGCGCTTCCGCGAACTCAACGCTTCGCAGAAGGCGCTGATGCTCTCGGCACGCAAGGAGGCCGG
CAAGTTCAGCGAGGGCGTCATCCTGTCCAAGTCGATGGAAGTGCTGTTCCGCGCCGTGCCGCCCAGCCTC
TACCTGGCGATGGCGATGACCGAGCCCGAGGAGAAGGCCGAACGCTTCCAGTTGATGCAGCAGCACGGCA
TCAGCGAGCTGGATGCCGCCTTCCGCGTGGCCGAGAAGATCGACCGTGCGCGGGGCATCGAACCGCTGGC
GCTGGATACGTTGGCCTGA
 Primer design