SecReT4
Protein ID: 339493299
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1222
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1284565..1285014 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDF8H212
KEGG IDpsz:PSTAB_1222
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.4e-40, Aligned region: 36..146
Protein Sequence: 149 a.a.     [Download]
>gi|339493299|ref|YP_004713592.1| hypothetical protein PSTAB_1222 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MPAHSLNLPAASRRPLATRLAAGLCAALLGPIAAAADVLIVTDSRHPVQAPAGVRIIELDQATRIEVELA
AHLPADPQQAAALVRQRLHDGGEALQRRIGHAYQGVADAWGLGIAKIPAVVVDRRYVVYGEPDVPRAVAR
IKAYRSTQP
 
Nucleotide Sequence: 450 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1284565-1285014 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGCCGGCTCATTCCCTCAACCTTCCTGCCGCTTCGCGGCGCCCCCTGGCCACGAGGCTGGCCGCTGGAC
TGTGCGCCGCGCTGCTCGGTCCCATCGCGGCGGCCGCCGATGTGCTCATCGTCACCGACAGCCGTCATCC
GGTGCAGGCCCCGGCCGGCGTGCGGATCATCGAGCTGGACCAGGCCACGCGCATCGAGGTCGAACTCGCC
GCGCACCTGCCGGCCGACCCGCAACAGGCCGCGGCCCTGGTGCGGCAGCGGTTGCATGACGGCGGCGAGG
CGCTCCAACGCCGCATCGGCCATGCCTACCAAGGTGTCGCGGATGCCTGGGGACTGGGCATCGCCAAGAT
TCCCGCCGTGGTGGTCGATCGACGCTACGTGGTCTACGGCGAGCCCGACGTGCCCCGCGCCGTCGCGCGC
ATCAAGGCCTACCGGAGCACGCAGCCATGA
 Primer design