SecReT4
Protein ID: 339493300
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1223
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1285011..1285955 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDF8H213
KEGG IDpsz:PSTAB_1223
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.1e-95, Aligned region: 32..302
Protein Sequence: 314 a.a.     [Download]
>gi|339493300|ref|YP_004713593.1| hypothetical protein PSTAB_1223 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MSLLLASRRLRATVASLLLSTATSTFALDTATIVSSALSPDCLEYRVVGICYWLYCTPFGCSVRTSVKVR
HYVPDAVVSSYSNTGENPWLEVRAMSMPNPTAKAGGDGTTNHDNENNLAKFKNADVIGHPAGMVFSQFAS
ASGYTCEGAGTAFMPYLLSTLDTIAWRYNIPEAFYPEALIPGRREIGTRTGLNLWGNVYPRGGFLHQTDD
HKSGAVVAQRAGDIVTRRNQIHVYQPLLANARDGYWPAGALMETDASTGKWQELTPTLSNSCVVFPHSRT
RVQAQQGDYAWALWRPYSCCRRRGQVFLGSVDFM
 
Nucleotide Sequence: 945 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1285011-1285955 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAGTCTCCTGCTGGCATCCCGGCGCCTGCGCGCCACCGTCGCCTCGCTGCTGCTGAGCACGGCCACGT
CGACGTTCGCCCTGGACACCGCCACCATCGTCTCGTCGGCGCTGTCCCCCGACTGCCTCGAATACCGCGT
GGTCGGTATCTGCTACTGGCTGTACTGCACGCCCTTCGGCTGCTCGGTTCGCACTTCCGTCAAGGTGCGC
CACTACGTCCCCGATGCGGTGGTGTCGAGCTACTCGAACACCGGCGAAAACCCGTGGCTGGAGGTCAGGG
CGATGAGCATGCCCAACCCGACCGCCAAGGCGGGCGGTGACGGCACGACCAACCACGACAACGAGAACAA
TCTCGCCAAGTTCAAGAACGCCGATGTCATCGGCCATCCGGCCGGGATGGTGTTCAGCCAGTTCGCCAGC
GCCTCCGGCTACACCTGCGAAGGCGCGGGCACGGCCTTCATGCCGTATCTGCTGAGCACGCTCGACACGA
TCGCCTGGCGCTACAACATCCCGGAAGCGTTCTACCCCGAAGCGCTCATCCCCGGCCGGCGCGAAATCGG
TACGCGCACCGGCCTGAACCTCTGGGGCAACGTGTATCCCCGCGGTGGCTTCCTGCACCAGACCGACGAC
CACAAGAGCGGCGCCGTGGTCGCGCAGCGCGCGGGCGACATCGTGACGCGCCGCAACCAGATTCACGTGT
ACCAGCCTCTGCTGGCCAACGCCCGCGACGGCTACTGGCCGGCCGGCGCGCTGATGGAGACCGACGCCTC
GACGGGCAAGTGGCAGGAGCTGACACCCACGCTCTCGAACAGTTGCGTGGTTTTCCCGCACAGCCGCACC
CGCGTGCAGGCCCAGCAAGGCGACTACGCCTGGGCCTTGTGGCGGCCGTACTCCTGCTGCCGGCGCCGTG
GCCAGGTCTTCCTCGGCAGCGTCGATTTCATGTGA
 Primer design