SecReT4
Protein ID: 339493301
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1224
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1285966..1287372 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDF8H2J9
KEGG IDpsz:PSTAB_1224
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|339493301|ref|YP_004713594.1| hypothetical protein PSTAB_1224 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MNASLPDFLHRAKSLLRATLLVAAITLVVGVAWAQTRIDPNGVNVSGSVIGDDVLYSIGGGRAVSMGGAG
NMQSIGVGVGWNSNLICGDMSITTTLQNQLNGITNGFQTIMSNVIQNATSAVASLPALIIQRADPGLYNL
LTNGILQARLDFDRSKMTCRAIANRMADMAGGQAGWDQLAEGMALRDAVSSTDAVSAIEQAESNKGNNGV
PWVGGGNAGGSGQSSIKVVGDVTRAGYNLLNGRSATDTSSIARSACGNRLTCQTWSSPQAAADWATRVLG
EREQRTCENCTKTQTTPGVGLTPMIQEEYETKLQALQELVTGARPTTLANLDAAGSSSLPITRGVIEALR
DEPDQDMLGRRLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVDQENSALEQEINNLKTELE
LRRTLAGNSAMAIIQRHSTRAAGSRGVFEGDTTRDRLREVQKPRSGTP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1285966-1287372 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGAACGCCTCCCTCCCTGACTTCCTGCACCGCGCGAAGTCGCTCCTGCGGGCCACGCTGCTCGTGGCGG
CCATCACGCTGGTCGTCGGCGTCGCCTGGGCGCAGACCCGCATCGACCCCAATGGCGTGAACGTCAGCGG
CAGCGTGATCGGCGACGACGTGCTCTACAGCATCGGCGGCGGCCGGGCCGTGTCGATGGGTGGTGCCGGC
AACATGCAGAGCATCGGCGTCGGCGTCGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCACCA
CGACGCTGCAGAACCAGCTCAACGGCATCACCAACGGCTTCCAGACGATCATGAGCAACGTGATCCAGAA
TGCCACCAGCGCCGTGGCCTCGCTGCCGGCGCTGATCATCCAGCGCGCCGACCCGGGTCTCTACAACCTG
CTGACCAACGGCATCCTCCAGGCGCGCCTGGACTTCGACCGCTCGAAGATGACCTGCCGGGCCATCGCCA
ATCGGATGGCGGACATGGCCGGCGGCCAGGCCGGCTGGGACCAGCTCGCCGAAGGGATGGCGCTGCGGGA
TGCGGTCAGCAGCACCGATGCCGTCTCCGCCATCGAGCAGGCCGAGTCCAACAAAGGGAACAACGGCGTG
CCCTGGGTCGGCGGCGGCAACGCGGGCGGCTCCGGTCAGAGTTCGATCAAGGTGGTCGGCGATGTGACGC
GCGCGGGCTACAACCTGCTCAACGGGCGCAGCGCCACCGATACCTCGTCGATCGCGCGCAGCGCCTGCGG
CAACCGCCTGACCTGCCAAACCTGGTCCTCGCCCCAGGCGGCCGCGGACTGGGCGACCCGCGTGTTGGGC
GAACGCGAGCAGCGCACCTGCGAAAACTGCACGAAGACCCAGACCACGCCTGGCGTCGGGCTGACGCCAA
TGATCCAGGAAGAGTACGAGACCAAGCTGCAGGCGCTGCAGGAACTGGTGACGGGCGCCCGGCCGACGAC
GCTGGCCAATCTCGACGCAGCCGGCAGCAGCTCGCTGCCGATCACCCGCGGCGTGATCGAGGCCCTGCGT
GACGAACCCGACCAGGACATGCTGGGCCGGCGCCTCGCGTCCGAGGCGGCGCTGTCCAGCGTGCTGGAGA
AGGCCCTGCTGCTGCAACGCACGTTGCTGACCGGCAAGAAGGAGCCGAACGTCGCCGCCAACGAGCTGGC
CGTGCAGGCGGTCGACCAGGAGAACAGCGCGCTGGAGCAGGAGATCAACAACCTCAAGACCGAGCTGGAG
CTGCGCCGCACGCTGGCCGGCAACTCGGCCATGGCGATCATCCAGCGCCACAGCACCCGCGCTGCCGGCT
CGCGCGGCGTCTTCGAGGGCGACACCACGCGCGACCGTCTGCGGGAAGTCCAGAAGCCGCGGAGCGGTAC
GCCATGA
 Primer design