SecReT4
Protein ID: 339493303
T4SS name [ID]Tfc [700]
Gene symbol-
Locus tagPSTAB_1226
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]1287738..1289261 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDF8H2K1
KEGG IDpsz:PSTAB_1226
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.2e-129, Aligned region: 10..492
Protein Sequence: 507 a.a.     [Download]
>gi|339493303|ref|YP_004713596.1| hypothetical protein PSTAB_1226 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MTLYTTDYLEYYLTLVAWVVNNGIWSILVASGVFALPFVAIVIQEWLKARSEGADEGNKGVLSSMRIENR
VWVAIVVIMFAGIPFIPVDLATIRFDTTRSAQCQVNVPLPNDTGWSNVYTALNDQSALVPVWWFFMHALS
KAVTGSAVAAIPCGTDLRQIRMDVDATRIDDPVLAQEVADFTHDCYGPSRAKLFMNRPTLSDEQMNDVTW
IGSSYFLDTPGFYDTYRAKTPRTAWPYDATRDAGLAQVDSGGGYPSCQQWWADGGQGLRSRLLAQVDPDL
LTRIGRWAGFLSQSEVNDSVIRAVVSPRQQKMNQGAVYTDYGGQIDKTLPNIVTRGASDLALTVGSLGFF
PAMDVVRQALPMVLTMLKMALVICIPLVLLIGTYDLKTVVTVSCVQFALFFVDFWFQLARWIDSTILDAL
YGWGFGADRPHTNFDPLIGLNNAFGDMLLNFVMAMMFIVLPTFWVMALAWAGVRTGNIVQGLSTATSDAK
GAGGRGAGMAMSAVSKK
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|339492077|ref|NC_015740.1|:1287738-1289261 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGACGCTCTACACCACGGACTACCTGGAGTATTACCTGACCCTGGTGGCTTGGGTGGTCAACAACGGCA
TCTGGAGCATCCTCGTGGCCAGCGGCGTGTTCGCGCTGCCGTTCGTGGCCATCGTGATCCAGGAATGGCT
CAAGGCCCGCAGCGAAGGTGCGGACGAAGGCAACAAGGGCGTGCTGTCGTCGATGCGCATCGAGAACCGG
GTGTGGGTGGCGATCGTGGTCATCATGTTCGCGGGCATCCCGTTCATCCCGGTGGATCTCGCCACGATCA
GGTTCGACACCACGCGCTCCGCGCAATGCCAGGTCAACGTCCCGCTGCCCAACGACACGGGCTGGTCCAA
CGTCTACACGGCGCTCAACGACCAGAGCGCGCTGGTGCCGGTGTGGTGGTTCTTCATGCACGCGCTGTCG
AAAGCCGTGACGGGCTCCGCGGTGGCGGCGATTCCCTGCGGCACGGACCTGCGTCAGATTCGCATGGATG
TGGATGCCACGCGCATCGACGATCCGGTGCTGGCACAGGAGGTCGCCGACTTCACGCACGACTGCTACGG
GCCGTCGCGCGCCAAGCTGTTCATGAACCGGCCGACGCTCTCCGACGAGCAGATGAACGACGTCACCTGG
ATCGGGTCGAGTTACTTCCTCGACACGCCCGGCTTCTATGACACCTATCGCGCCAAGACCCCACGCACGG
CCTGGCCCTACGACGCGACCCGCGATGCGGGGCTGGCACAGGTGGACAGCGGCGGCGGCTATCCGTCCTG
CCAGCAGTGGTGGGCCGATGGCGGCCAGGGACTGCGTAGCCGGCTGCTGGCACAGGTCGACCCGGACCTG
CTGACCCGCATCGGGCGCTGGGCGGGCTTCCTGTCGCAGAGCGAGGTCAATGACTCGGTGATCCGCGCCG
TCGTCTCACCGCGGCAGCAGAAGATGAACCAGGGCGCCGTCTACACCGACTACGGCGGCCAGATCGACAA
GACGCTGCCGAACATCGTCACGCGCGGCGCGAGCGACCTGGCGCTGACCGTCGGCTCGCTGGGCTTCTTT
CCGGCGATGGACGTGGTGCGCCAGGCGCTGCCGATGGTGCTGACCATGCTCAAGATGGCGCTCGTCATCT
GCATCCCGTTGGTGCTGCTGATCGGCACCTACGACCTGAAGACGGTGGTGACGGTGAGCTGCGTCCAGTT
CGCGCTGTTCTTCGTGGACTTCTGGTTCCAGCTCGCGCGCTGGATCGACAGCACGATCCTGGATGCGCTC
TACGGCTGGGGGTTTGGCGCGGACAGGCCGCACACGAACTTCGATCCGTTGATCGGTTTGAACAACGCCT
TTGGCGACATGCTCCTTAACTTCGTCATGGCGATGATGTTCATCGTGCTGCCGACGTTTTGGGTCATGGC
ATTGGCTTGGGCAGGCGTTCGCACGGGAAATATCGTGCAGGGGTTGTCCACCGCCACCTCGGACGCCAAG
GGCGCTGGGGGGCGTGGCGCTGGTATGGCAATGAGCGCTGTATCGAAGAAGTGA
 Primer design