SecReT4
Protein ID: 339494550
T4SS name [ID]Tfc [701]
Gene symbol-
Locus tagPSTAB_2473
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]2669327..2670559 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDF8H282
KEGG IDpsz:PSTAB_2473
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 410 a.a.     [Download]
>gi|339494550|ref|YP_004714843.1| hypothetical protein PSTAB_2473 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MFADLALRNVDGHAWTFESRAMHAINSYRSCLLLAALAAGCTTPPAPSPVPDEVATPSQDVPFTRYGRYN
LVELTPTVAQQDLLLQVVDVSIPDTLNANVADALRHVLQRSGYQLCNGRETDTLGSLPLPAAHYHLGPLQ
LRNALLALAGPARTLHVDHSARRVCFIQPFNKPADAPPATADTEPDVVGGVAAMTTMPGRGQHRLGTLLR
AATITWLLLISAAVVIDHVALSGLAAQVETSTPSLQVDVLEERLAERVQQIEQAQQQPDALPQARYEAER
QALEQRLDAIEQALGSRPTADNLLPLQARIEQLEMRLTAPRPTPPATTRPRVSAPAKPKIIEPPFRVIGV
ELRAGEQFLSILPSISDALSQVRLLRPGEAEAGWHLETIEANTAVFRYGEDTRRLPVPVQ
 
Nucleotide Sequence: 1233 bp     [Download]
>gi|339492077|ref|NC_015740.1|:2669327-2670559 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
TTGTTTGCTGATCTCGCTCTGCGAAATGTCGATGGTCACGCCTGGACCTTCGAGAGCCGAGCCATGCATG
CCATCAATTCCTACCGCAGCTGCCTGCTGCTGGCCGCACTGGCGGCCGGCTGTACAACGCCTCCAGCGCC
CTCTCCCGTTCCTGATGAAGTAGCAACTCCGTCACAGGACGTCCCTTTCACCCGCTACGGTCGCTACAAC
CTTGTCGAGCTGACCCCGACGGTCGCCCAGCAGGATCTGCTGTTGCAGGTCGTCGACGTATCCATTCCCG
ACACCCTTAACGCCAATGTCGCCGACGCGCTGCGCCATGTGTTGCAGCGTTCCGGCTACCAACTCTGCAA
CGGACGTGAAACCGACACGCTGGGCAGCCTCCCGTTGCCGGCTGCGCACTATCACCTTGGCCCGCTGCAG
CTGCGCAATGCCCTACTGGCCTTGGCCGGGCCGGCGCGGACGCTGCACGTCGACCACAGCGCCCGTCGCG
TCTGCTTCATCCAGCCCTTCAACAAGCCAGCCGACGCGCCGCCCGCCACTGCGGATACAGAGCCCGATGT
CGTCGGGGGAGTCGCAGCCATGACAACGATGCCAGGCAGAGGGCAACACCGGCTCGGCACGCTGCTGCGC
GCAGCTACTATCACCTGGCTGCTGCTCATCAGCGCTGCCGTTGTGATCGATCATGTCGCGCTGTCGGGGC
TAGCGGCACAGGTCGAAACCAGCACACCCAGCCTGCAAGTCGACGTGCTGGAAGAACGCCTGGCAGAACG
GGTCCAGCAGATCGAACAAGCCCAGCAGCAACCGGACGCACTACCTCAAGCGCGCTACGAAGCAGAGCGC
CAAGCGCTGGAGCAGCGACTGGACGCCATCGAACAGGCGCTCGGCAGCCGCCCGACAGCGGACAACCTGC
TGCCGCTGCAAGCCCGCATCGAGCAGCTGGAAATGCGGCTCACCGCACCTCGCCCGACACCACCAGCCAC
AACCCGCCCGCGAGTTTCCGCACCCGCCAAACCGAAGATCATCGAGCCGCCATTCCGAGTGATCGGGGTC
GAGCTGCGCGCCGGTGAGCAGTTCCTCTCGATTCTGCCATCCATCTCGGACGCGCTCTCGCAGGTTCGCC
TGCTGCGCCCCGGCGAGGCCGAAGCCGGCTGGCATCTCGAAACCATCGAAGCGAACACCGCCGTGTTCCG
CTACGGCGAAGACACCCGTCGCCTGCCTGTTCCCGTGCAGTAG
 Primer design