SecReT4
Protein ID: 339494552
T4SS name [ID]Tfc [701]
Gene symbol-
Locus tagPSTAB_2475
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]2671294..2671857 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDF8H284
KEGG IDpsz:PSTAB_2475
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 187 a.a.     [Download]
>gi|339494552|ref|YP_004714845.1| hypothetical protein PSTAB_2475 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MSRRYALVLLACALAGPIQAREIPPPAYQVAAQRAGIPSTVLYAITLQESGIRLRGRLVPWPWTLNVAGK
AQRYATRAEACGGLRQALRRTPAKRIDAGLGQVNLGYHAERYAQPCDLLDPYRNLAIAAEILREQHTPSD
DWLLTIGRYHRPAGGEPAARYRRSVGQHLARILGASKLEITARRNLP
 
Nucleotide Sequence: 564 bp     [Download]
>gi|339492077|ref|NC_015740.1|:2671294-2671857 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGTCACGCCGCTACGCACTCGTGCTGTTGGCCTGCGCACTGGCAGGCCCCATCCAGGCGCGGGAAATCC
CGCCGCCGGCCTATCAAGTCGCTGCGCAGCGCGCCGGTATTCCCTCGACCGTGCTGTACGCCATCACGTT
GCAAGAGAGCGGCATCCGTTTGCGTGGCCGTCTGGTGCCATGGCCGTGGACGCTCAACGTAGCTGGCAAG
GCGCAGCGCTACGCCACCCGTGCTGAGGCTTGCGGCGGGCTGCGCCAGGCACTCAGGCGCACACCCGCCA
AGCGCATTGACGCCGGTCTCGGCCAGGTCAATCTCGGCTACCACGCGGAGCGTTATGCGCAGCCCTGCGA
CCTGCTCGACCCCTACCGCAACCTCGCCATCGCCGCCGAAATTCTGCGTGAACAGCACACCCCAAGCGAC
GACTGGCTGCTCACCATCGGCCGCTACCACCGCCCCGCTGGCGGCGAACCAGCCGCGCGCTACCGCCGCA
GCGTCGGCCAGCACCTAGCCCGCATACTGGGTGCCTCCAAGCTGGAAATCACCGCCCGAAGGAATCTGCC
ATGA
 Primer design