SecReT4
Protein ID: 339494555
T4SS name [ID]Tfc [701]
Gene symbol-
Locus tagPSTAB_2478
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]2674134..2674799 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDF8H287
KEGG IDpsz:PSTAB_2478
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.5e-69, Aligned region: 18..218
Protein Sequence: 221 a.a.     [Download]
>gi|339494555|ref|YP_004714848.1| hypothetical protein PSTAB_2478 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MLGVLIGSLLMSIIIECVGMHLFWSEQGWRHSQSMLDYELNHLSSHFTRSAVVQEPGRTARLLVDGAYEW
IFVKTGLLDWMGQASALARAPSHSGARDIRHCISQIYVWSENYLIAAAFTTLTFVVRLLVLMLTLPLFLM
AAFVGLIDGLVRRDIRKFGAGRESGFVYHRAKASLMPLAILPWIIYLTLPVSVHPLLILLPSAALLALAV
NITAASFKKYL
 
Nucleotide Sequence: 666 bp     [Download]
>gi|339492077|ref|NC_015740.1|:2674134-2674799 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGCTCGGCGTGTTGATCGGCTCGCTTCTGATGTCGATCATTATCGAGTGCGTCGGCATGCACTTGTTCT
GGTCTGAACAGGGCTGGCGTCACTCCCAAAGCATGCTTGACTACGAACTGAACCACCTTTCCAGCCACTT
CACCCGAAGCGCGGTGGTACAGGAGCCAGGCCGTACCGCGCGCCTGTTGGTCGATGGAGCCTACGAATGG
ATTTTCGTGAAGACCGGACTGCTCGACTGGATGGGCCAAGCATCGGCACTCGCCCGTGCGCCCAGCCATA
GTGGCGCACGGGACATCCGCCACTGCATCAGCCAGATCTACGTTTGGAGCGAGAACTATCTGATCGCCGC
GGCATTCACGACGCTGACATTCGTCGTCCGCCTGCTGGTCCTGATGCTGACGCTGCCCCTGTTCCTCATG
GCTGCCTTCGTCGGCCTCATCGACGGACTGGTGCGGCGTGACATCCGCAAATTCGGTGCGGGCCGCGAAT
CGGGCTTCGTCTACCACCGTGCCAAGGCGAGTCTGATGCCGCTGGCGATCCTGCCGTGGATCATCTACCT
CACCCTGCCCGTCAGCGTACATCCGCTGCTGATATTGCTGCCGAGCGCGGCGCTGCTCGCCCTGGCTGTG
AACATCACCGCAGCCAGTTTCAAGAAATATTTGTGA
 Primer design