SecReT4
Protein ID: 339494556
T4SS name [ID]Tfc [701]
Gene symbol-
Locus tagPSTAB_2479
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]2674931..2675302 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDF8H288
KEGG IDpsz:PSTAB_2479
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 9.7e-28, Aligned region: 32..110
Protein Sequence: 123 a.a.     [Download]
>gi|339494556|ref|YP_004714849.1| hypothetical protein PSTAB_2479 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MSMQPLPPADRHHAPGLTFALLLGLCFSAHASADDATFEHARLAAALRQLDSIERLVAQQTAQQRDERAR
YHFDYARLTADLERVRAGIHDYLTPTRAQPRDPALLLGDYRQSTAALEPLVTP
 
Nucleotide Sequence: 372 bp     [Download]
>gi|339492077|ref|NC_015740.1|:2674931-2675302 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGTCGATGCAACCTCTCCCACCAGCCGATAGGCATCACGCGCCCGGCCTGACCTTCGCACTGCTGCTCG
GCCTGTGTTTTTCTGCACATGCCAGCGCCGACGATGCCACGTTCGAGCACGCACGGCTCGCAGCCGCGCT
GCGCCAGCTCGACAGCATCGAACGGCTTGTCGCACAACAAACCGCGCAGCAGCGGGACGAACGCGCCCGC
TACCACTTCGACTACGCCCGTCTGACCGCTGACCTTGAGCGCGTGCGCGCCGGCATCCACGACTACCTCA
CCCCAACGCGTGCGCAACCGCGCGACCCCGCCCTGCTGCTTGGCGACTACCGCCAGTCTACCGCCGCCCT
CGAACCGCTGGTCACGCCATGA
 Primer design