SecReT4
Protein ID: 339494559
T4SS name [ID]Tfc [701]
Gene symbol-
Locus tagPSTAB_2482
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]2675924..2676319 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDF8H291
KEGG IDpsz:PSTAB_2482
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.1e-45, Aligned region: 8..129
Protein Sequence: 131 a.a.     [Download]
>gi|339494559|ref|YP_004714852.1| hypothetical protein PSTAB_2482 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MAEDIRPDGTVAFLPHRLNRHPVVVRGLTANELWVCAGLSGVIGLASGIPLAFMFTTIAIVPTAILLAVT
AGIFIGGGALRRFKRGRPKTWLYRQLQWWIAVNLPQLAPLTDSHALVTRSGYWSTRRSKAR
 
Nucleotide Sequence: 396 bp     [Download]
>gi|339492077|ref|NC_015740.1|:2675924-2676319 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGGCTGAAGACATCCGCCCGGACGGGACGGTGGCGTTCTTGCCCCACCGCCTCAACCGTCACCCCGTGG
TGGTGCGAGGGCTGACGGCAAATGAACTGTGGGTCTGCGCGGGATTATCAGGCGTGATCGGTCTCGCGAG
CGGCATCCCGCTGGCCTTCATGTTTACAACGATTGCCATCGTCCCCACAGCCATCCTGCTGGCGGTCACC
GCTGGGATTTTCATCGGTGGCGGCGCGCTGCGCCGATTCAAACGCGGCCGCCCCAAAACCTGGCTGTATC
GGCAGTTGCAGTGGTGGATCGCAGTTAATCTGCCGCAGCTCGCGCCGCTCACCGACAGTCACGCCCTGGT
AACTCGCTCCGGTTACTGGAGCACACGCCGGAGCAAGGCGCGGTGA
 Primer design