SecReT4
Protein ID: 339494568
T4SS name [ID]Tfc [701]
Gene symbol-
Locus tagPSTAB_2491
StrainPseudomonas stutzeri ATCC 17588 = LMG 11199
Repliconchromosome [GenBank: NC_015740] [Browse all T4SS(s) in this replicon]
Location [Strand]2685149..2686486 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDF8H2T4
KEGG IDpsz:PSTAB_2491
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 445 a.a.     [Download]
>gi|339494568|ref|YP_004714861.1| hypothetical protein PSTAB_2491 [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
MMASTNTFAQTSVNQHGVQHQGSVIGDDVLYSIGGGQAVSMTPAPNMRSIGVGVGWNSNLICGDMSISTT
IQNQLNGVTNGFQTIMSSVIQNATAAVASLPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCRAMAEK
MGDMAGGQIGWSQLADGMVLKQAVSSTDAVSAIEQTEASRGNEGVAWVGGENAGGTGQRPIRVVSDVTRA
GYNLVNGRDVDDTSSIDPSSCGGNLTCQTWNSPAAASAWAVRVLGEQEQRTCEACTKTMATPGVGLTPLI
QEEYEERLEVLQGLIAGSQPLSFDNLQTAGSASLPITRGVVEALRDEPDQDILARRLASEIALSSVLEKA
LLLQRTLLTGRKEPNVAANELAQKAVSHESDLLDREIHNLKTELELRRELASNSPTAIIQRHSARSAGSR
GIYQGDPARDRLDQLQRPPSSGSTP
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|339492077|ref|NC_015740.1|:2685149-2686486 Pseudomonas stutzeri ATCC 17588 = LMG 11199 chromosome, complete genome
ATGATGGCGAGCACAAACACATTCGCTCAGACCAGCGTCAACCAGCATGGTGTGCAACACCAGGGCTCCG
TGATCGGTGACGATGTGCTGTATTCGATCGGCGGCGGCCAGGCCGTGTCGATGACACCCGCGCCCAATAT
GCGCTCCATTGGCGTCGGCGTCGGCTGGAACAGCAATCTGATCTGCGGCGACATGTCTATCTCGACCACG
ATCCAGAACCAGCTGAACGGCGTGACCAACGGGTTCCAGACCATCATGTCGTCAGTTATTCAGAACGCTA
CGGCCGCCGTAGCGTCGTTGCCAGCACTGATCATCCAGAGGGCAGACCCAGGGCTCTATAACCTGCTCAC
CAACGGCGTGTTGCAGGCTCGGCTGGACTTCGACCGCTCCAAACTGACCTGTCGCGCAATGGCGGAGAAA
ATGGGCGACATGGCTGGCGGCCAGATCGGATGGAGCCAGCTCGCCGATGGGATGGTACTTAAGCAAGCCG
TATCCAGCACCGACGCTGTATCTGCCATTGAGCAGACCGAAGCGAGCCGCGGCAATGAAGGGGTGGCCTG
GGTCGGTGGCGAGAATGCGGGAGGCACAGGGCAGCGCCCGATTCGCGTCGTCAGTGATGTCACCCGCGCC
GGTTACAACCTGGTTAACGGGCGCGATGTCGACGACACCAGCTCGATCGATCCGAGCAGTTGCGGTGGCA
ACCTGACCTGCCAGACCTGGAACTCGCCCGCCGCAGCCTCAGCCTGGGCCGTACGGGTGTTGGGCGAGCA
AGAGCAGCGCACATGCGAAGCATGCACCAAGACCATGGCGACGCCCGGCGTCGGCCTGACCCCGCTGATC
CAGGAGGAATACGAGGAGAGGCTCGAAGTACTACAGGGGCTGATCGCCGGCAGCCAGCCCCTGAGCTTCG
ACAATTTACAAACGGCCGGCAGCGCCTCGCTGCCGATTACGCGCGGCGTGGTCGAAGCACTGCGCGATGA
ACCCGACCAAGACATCCTGGCGCGACGCCTCGCTTCGGAAATCGCCTTGTCCAGCGTGCTCGAAAAAGCA
CTGCTGCTGCAACGTACCCTGCTGACTGGACGCAAAGAACCGAACGTTGCAGCCAACGAACTGGCGCAAA
AAGCAGTTTCACACGAAAGCGACCTACTCGACCGCGAAATCCATAACCTGAAAACCGAGCTGGAGCTGCG
CCGCGAGCTGGCGAGCAATTCGCCCACTGCCATCATCCAGCGTCACAGCGCACGCTCTGCGGGCTCGCGA
GGCATCTATCAAGGTGATCCGGCCCGCGACCGGCTCGATCAGTTGCAGCGCCCACCAAGCAGCGGGAGCA
CTCCATGA
 Primer design