SecReT4
Protein ID: 340791825
T4SS name [ID]VirB [366]
Gene symbolvirB11
Locus tagBPI_II61
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]56840..57934 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDF9YLL6
KEGG IDbpp:BPI_II61
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.5e-66, Aligned region: 28..330
Protein Sequence: 364 a.a.     [Download]
>gi|340791825|ref|YP_004757289.1| type IV secretion system protein VirB11 [Brucella pinnipedialis B2/94]
MCMMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYE
HLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFF
KHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITI
EDVPELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHG
GSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPN
TKRALSLQHSEKTQ
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c57934-56840 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
GTGTGTATGATGTCAAACCGAAGTGACTTTATTGTGCCTGACGAGGCGGCCGTCAAACGGGCGGCCTCGG
TCAATTTCCATCTGGAACCGCTGCGCCCTTGGTTGGACGATCCGCAGATCACCGAAGTTTGCGTGAACCG
GCCGGGCGAAGTGTTCTGCGAGCGAGCAAGCGCGTGGGAATACTATGCGGTGCCAAACCTCGACTATGAA
CACCTGATTTCGCTGGGAACCGCCACCGCGCGGTTTGTGGATCAGGATATTTCGGACAGCCGACCGGTGC
TGTCTGCGATCCTGCCGATGGGTGAGCGCATTCAGATTGTGCGCCCGCCCGCATGTGAGCACGGCACCAT
CTCGGTGACGATCCGCAAGCCGTCTTTCACCCGGCGCACACTGGAAGACTATGCGCAGCAGGGCTTTTTC
AAACACGTCAGACCCATGAGTAAGAGCCTGACGCCGTTTGAACAGGAACTGCTCGCATTGAAGGAAGCTG
GTGATTACATGAGCTTCCTGCGGCGGGCGGTACAGCTTGAAAGGGTGATCGTCGTCGCCGGCGAGACGGG
ATCAGGCAAGACCACACTGATGAAAGCGCTGATGCAGGAAATTCCGTTCGATCAGCGCCTGATCACCATC
GAGGACGTACCGGAGTTGTTCTTGCCGGACCATCCGAACCACGTCCACCTGTTTTATCCGAGCGAAGCGA
AGGAAGAAGAAAACGCACCAGTGACGGCCGCCACGCTACTGCGGAGCTGCCTGCGCATGAAACCGACGCG
CATCCTGCTTGCCGAGCTGCGCGGCGGCGAGACTTACGATTTCATCAACGTGGCCGCGTCCGGCCATGGC
GGCAGCATCACCAGTTGCCATGCCGGTTCGTGCGAACTGACTTTCGAGCGGCTGGCATTGATGGTGTTGC
AGAACCGCCAGGGCCGCCAGTTGCCATACGAGATCATCCGCCGGCTGCTCTATCTGGTGGTGGATGTCGT
CGTGCACGTCCACAATGGCGTGCACGACGGCACTGGCCGCCATATATCTGAAGTTTGGTACGACCCGAAT
ACAAAACGGGCACTGTCACTGCAACACAGTGAGAAGACGCAATGA
 Primer design