SecReT4
Protein ID: 340791826
T4SS name [ID]VirB [366]
Gene symbolvirB10
Locus tagBPI_II62
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]57909..59075 [-]
Producttype IV secretion system protein VirB10
Component typeVirB10
UniProt IDC9U082
KEGG IDbpp:BPI_II62
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.7e-61, Aligned region: 201..379
Protein Sequence: 388 a.a.     [Download]
>gi|340791826|ref|YP_004757290.1| type IV secretion system protein VirB10 [Brucella pinnipedialis B2/94]
MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAENNHHSDKTMVQ
TSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKS
SGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINC
ALQTRLDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDL
DSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTA
LKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c59075-57909 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGACACAGGAAAACATTCCGGTGCAGCCGGGCACACTTGACGGTGAGCGTGGCCTACCCACCGTGAACG
AAAACGGCTCCGGCCGCACCCGCAAGGTGTTGCTCTTTCTCTTTGTCGTGGGCTTCATCGTCGTGCTGCT
GTTGCTGCTCGTGTTTCACATGAGGGGCAATGCAGAGAATAATCACCATTCAGACAAGACGATGGTGCAG
ACCAGCACAGTTCCGATGCGAACTTTCAAGCTGCCACCCCCGCCACCACCAGCACCACCAGAACCACCAG
CCCCGCCACCGGCCCCAGCCATGCCCATCGCGGAACCCGCAGCGGCGGCGCTGAGCCTGCCACCATTGCC
GGATGATACGCCGGCAAAGGACGATGTACTGGACAAGTCGGCCAGCGCGTTGATGGTCGTCACCAAGTCC
AGCGGCGATACGAACGCTCAAACGGCCGGCGATACGGTCGTTCAAACGACCAATGCGCGCATTCAAGCCC
TGCTCGACAGTCAAAAGAACACCAAGCAGGATGCTGGATCGCTGGGTACTCTCCTTCACGGCACACAAAC
GGATGCACGCATGGCGAGCCTTCTGCGCAACCGTGATTTCCTGCTCGCGAAGGGCAGCATCATCAATTGC
GCGCTGCAAACCCGTCTGGATTCGACGGTGCCGGGCATGGCTGCCTGCGTGGTCACACGCAACATGTATA
GCGATAACGGCAAGGTGTTGCTGATTGAGCGCGGTTCAACCATCTCGGGTGAATATGATGCCAACGTAAA
GCAGGGCATGGCTCGCATTTATGTCCTGTGGACGCGCGTGAAGACGCCGAACGGTGTCGTGATCGATCTC
GACTCTCCAGGCGCCGACCCCCTGGGCGGGGCAGGCTTGCCCGGCTACATCGACTCCCACTTCTGGAAGC
GCTTTGGCGGCGCCTTGATGTTGAGCACGATCGAGACCCTCGGCCGCTATGCAACCCAGAAGGTCGGCGG
CGGGGGTTCAAATCAGATCAACCTCAATACCGGCGGAGGTGAATCGACGAGCAACCTGGCTTCAACTGCC
TTGAAGGATACGATCAACATTCCGCCGACACTGTACAAGAACCAGGGCGAAGAGATCGGCATCTATATCG
CCCGCGACCTAGATTTTTCGAGTGTGTATGATGTCAAACCGAAGTGA
 Primer design