SecReT4
Protein ID: 340791827
T4SS name [ID]VirB [366]
Gene symbolvirB9
Locus tagBPI_II63
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]59072..59941 [-]
Producttype IV secretion system protein VirB9
Component typeVirB9
UniProt IDC9U083
KEGG IDbpp:BPI_II63
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-64, Aligned region: 29..259
Protein Sequence: 289 a.a.     [Download]
>gi|340791827|ref|YP_004757291.1| type IV secretion system protein VirB9 [Brucella pinnipedialis B2/94]
MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVLVRALPGVGARIVFAPGENIEDVASGF
TQGWEFKASHNILYLKARSMTLSHSNQSIDMAPEPGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRV
QFRYPAAAAAAAVAAAQKRVVQARMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFP
AAFLVAEDKSESIVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPGVKRV
IKSPGENLQ
 
Nucleotide Sequence: 870 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c59941-59072 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGAAAAGATTCCTGCTTGCGTGCATACTGATCACGTTGGCCTCGCCCTCCTGGGCAACCAAAATCCCGT
CCGGCTCAAAATACGACAGCCGAATTCAGTATGTCGATTACAATTCCGGCGATGTCGTGCTGGTTCGGGC
CCTGCCCGGCGTTGGCGCACGCATCGTGTTTGCGCCGGGCGAGAATATTGAGGATGTCGCCTCAGGATTT
ACGCAAGGCTGGGAGTTCAAGGCGAGCCACAACATCCTGTATCTCAAGGCCCGCTCCATGACGCTCTCCC
ACTCGAACCAATCGATCGACATGGCCCCGGAACCGGGCAAGTGGGACACAAACCTGATGGTCACGACAGA
TCAGCGCATGTACGATTTCGATTTGCGCTTGATGCCCGGCCGCAACAATCAGCGTGTTGCCTATCGTGTT
CAGTTCCGCTACCCGGCGGCAGCGGCAGCGGCGGCAGTAGCAGCCGCGCAAAAGCGAGTGGTACAGGCCC
GCATGAATGCCAGACCGTCGCCGGTAAACTGGAACTACACGATGCAGGTCGGCACTAATTCGGCCAGCAT
CGCGCCCACTCTTGCCTATGACGATGGGCGGTTCACATATTTGCGCTTTCCGAACAACAGAGACTTTCCG
GCCGCTTTCCTTGTCGCCGAAGACAAGTCGGAAAGCATCGTGAACAGCCATATAGACCCGTCAGCGCCGG
ACATTCTGGTCCTGCATCGGGTCGCAAAGCAAATGGTGCTGCGCCTCGGTAACAAGGTGATTGGCATCTA
CAACGAATCCTTCAATCCTGATGGCGTTCCCGCACGCGACGGAACCACAGTGCCAGGCGTCAAGCGCGTC
ATCAAATCGCCCGGGGAGAACCTGCAATGA
 Primer design