SecReT4
Protein ID: 340791829
T4SS name [ID]VirB [366]
Gene symbolvirB7
Locus tagBPI_II65
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]60660..60833 [-]
Producttype IV secretion system protein VirB7
Component typeVirB7
UniProt IDC9U085
KEGG IDbpp:BPI_II65
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|340791829|ref|YP_004757293.1| type IV secretion system protein VirB7 [Brucella pinnipedialis B2/94]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c60833-60660 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design