SecReT4
Protein ID: 340791830
T4SS name [ID]VirB [366]
Gene symbolvirB6
Locus tagBPI_II66
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]60997..62040 [-]
Producttype IV secretion system protein VirB6
Component typeVirB6
UniProt IDF9YLM1
KEGG IDbpp:BPI_II66
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.1e-47, Aligned region: 42..269
Protein Sequence: 347 a.a.     [Download]
>gi|340791830|ref|YP_004757294.1| type IV secretion system protein VirB6 [Brucella pinnipedialis B2/94]
MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGPFSQLVISCIK
FMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRG
LTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIV
TSILQVALLSAVLSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISA
ATISLGSLAVNTATSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c62040-60997 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGGTTAATCCTGTAATCTTTGAGTTCATCGGCACTTCGATCCACAACCAGTTGAACAATTACGTGACTA
TGGTGGCATCCAACACCATGAATATGATTGCCACGACTGCTGTCCTCGCCGGTGGCCTCTACTATACCGC
CATGGGCATATTGATGTCTGTGGGGCGGATCGAAGGGCCGTTTTCGCAACTCGTCATAAGCTGTATTAAA
TTCATGCTGATTGCTGCTTTTGCGCTCAATATCAGCACCTATTCGGAGTGGGTGATCGATACGGTGCACA
ACATGGAGTCCGGATTTGCCGACGCCTTTGCCGGCAATCACGGCACCCCTTCCAGCACGATCTACCAGAC
CCTCGACAATTCGTTGGGCAAGGGGTGGAACATCGCAGCCATGCTCTTTGAGAAAGGCGATAATCGCGGC
CTGACCCAGATCGTGCAGGGCTTTTCAGAACTGTTACTGTCATTCCTGGTAGCCGGCTCAACGCTTATCC
TTGCAGGCCCGACTGGTGCGATGATCGTCGCAACCAATGCGGTGATCGCGATCCTGCTCGGAATCGGCCC
TCTCTTCATCCTCGCCCTTGGCTGGGCGCCGACAAGGGGCTTCTTCGATCGCTGGTTCGGGGCCATCGTC
ACATCGATCCTTCAGGTCGCGCTTTTGTCGGCCGTGCTATCTATATCGAGTGCAATCTTCAGCCGCATGG
TGGCGGCCATCAATTTGGCTTCCGCAACACAAAGCACGCTCTTTTCCTGCCTCTCACTGACCGCTGTAAC
GATTGTCATGCCGTATATGATGTACAAGGTCTATGAATACGGTGGCATCCTGGGCAGCAGCATATCGGCG
GCCACGATCTCCCTCGGCTCACTTGCAGTCAATACCGCGACATCTGGTGGTGGCGCTATGACGAGCATAT
TCAGCGGATCATCCGGCGGCGGGGGTTCCGGCTCGGCGAAGGCGGGCGGGGAAAGCAGTTATTCGGCTGG
TGGCAACGCCATGTGGAGCCCGGCTTACCGGCAACACGTGCTCGGCCAGTTCAACAGGGATTAG
 Primer design