SecReT4
Protein ID: 340791831
T4SS name [ID]VirB [366]
Gene symbolvirB5
Locus tagBPI_II67
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]62224..62940 [-]
Producttype IV secretion system protein VirB5
Component typeVirB5
UniProt IDC9U087
KEGG IDbpp:BPI_II67
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 4.2e-66, Aligned region: 21..217
DUF4141 [PF13605], Evalue: 8.4e-07, Aligned region: 1..43
Protein Sequence: 238 a.a.     [Download]
>gi|340791831|ref|YP_004757295.1| type IV secretion system protein VirB5 [Brucella pinnipedialis B2/94]
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKMQFDALTGNRG
LGDILRDPTLRSYLPHNWRGLYEAVMSGGYLAAAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPV
QDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLHLYQQMAEAQDKL
LDERQHELDAKDNARRGYPQPKALEAAY
 
Nucleotide Sequence: 717 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c62940-62224 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGAAGAAGATAATTCTCAGCTTCGCATTCGCCCTGACTGTAACCAGCACGGCGCACGCACAGCTCCCGG
TGACAGATGCCGGCTCCATCGCGCAGAACCTGGCCAACCATCTCGAACAGATGGTGAAGTTCGCCCAGCA
GATCGAGCAACTGAAACAGCAGTTTGAACAACAGAAAATGCAGTTCGATGCCCTGACCGGCAACCGTGGC
CTTGGCGATATTCTCCGCGACCCTACGCTGCGTAGCTATCTGCCACATAACTGGCGAGGTCTCTACGAAG
CGGTGATGAGCGGCGGCTACCTGGCGGCGGCTGGCGAAACGGCCAACCTCTTACGCAAAAGCCAGGTATA
CGATCCGTGTGCCTCCATCTCCGACAAAGATCAGCGCATCGCATGTGAGGCTAAAGTGGTGAAGCCGGTC
CAGGACAAGGTCATGACGTCCAAAGCCTACGACGCCACTGACAAACGCCTACAAGAGATCGAGAGCTTGA
TGCAGGAGATCAACAAGACGGGAGACCCGAAGGCGATTGCCGAATTGCAAGGCCGGATCGAAAGCGAAAA
TGCCATGATCCAAAACGAAGACACCCGCCTTCATCTCTACCAGCAGATGGCAGAGGCACAGGACAAGCTC
CTGGACGAACGCCAGCACGAATTAGACGCGAAGGATAATGCCCGGCGCGGCTATCCGCAGCCGAAAGCAC
TGGAAGCCGCCTATTAA
 Primer design