SecReT4
Protein ID: 340791832
T4SS name [ID]VirB [366]
Gene symbolvirB4
Locus tagBPI_II68
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]62945..65440 [-]
Producttype IV secretion system protein VirB4
Component typeVirB4
UniProt IDC9U088
KEGG IDbpp:BPI_II68
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 8.1e-73, Aligned region: 184..388
AAA_10 [PF12846], Evalue: 7.6e-24, Aligned region: 452..744
Protein Sequence: 831 a.a.     [Download]
>gi|340791832|ref|YP_004757296.1| type IV secretion system protein VirB4 [Brucella pinnipedialis B2/94]
MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFR
AIASNNVALWSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFN
VAVHRSHAEILQEQQLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSG
EWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDYASHTEPGILNGLMYSDYEYVITQ
SFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGQGDFVMGEYHYSLLVFAEDMETVRHNT
SHAMNILQDNGFLATVIATATDAAFYAQLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQAL
TLLKTPSGQPAYLNFHYSKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFF
DKDQGAKGTILAIGGKYLAIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAI
RTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQIDFNTHSN
YGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFSEFANNKQLTIRKQNGLGV
FATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTDGFKVTNEEFDIIRSMSEESRMFLVKQGHHS
MICRLELNGFDDELAILSGSSDNNELLDQVIAEVGDDPSVWLPVFQERRKARIASSKSTGR
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c65440-62945 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGGGCGCTCAATCCAAATACGCGCAACAGCTCAATAATGAACGGTCACTTGCACCGTTCATTCCCTTCA
GGAGCCAGGTTGGCCCGACCACCGTGATAACGCGTGACGGTGATTTCGTGCGCACATGGCGCATCGCGGG
CCTGGCTTTCGAGACGCAGGACAAGGAGAAACTGTTGATCCGCAAGGACCAGCTTAACACCTTGTTCCGT
GCCATCGCCTCAAACAATGTGGCGCTGTGGTCCCACAACGTACGGCGCAGAACCTGGGATCACTTGAAAT
CCTTCTTTTCCAATCCGTTCTGCGACGCTCTCGACAAGAAGTATTACGGATCGTTTTCCGGCTACCGAAT
GATGTCAAACGAACTGTATCTGACGGTTATTTACCGGCCAGTGCCGGCGAAGATCAGCAGGTTGTTCAAC
GTGGCCGTTCATCGTTCGCATGCGGAAATCTTACAGGAGCAGCAGCTTGCCATCCGCAAGCTGGACGAAA
TCGGCAATCAAATTGAAACCAGCTTGCGTCGCTACGGTGGCGATGACGGGCGTGGCATCGAAGTGCTGAG
CACCTATGAGGACAAACACGGCGCACTGTGCTCACAGCAGCTTGAATTTTATAACTTCCTTCTCTCAGGC
GAATGGCAGAAGGTGCGCGTGCCATCCTGCCCACTGGATGAATATCTGGGCACCGGGTGGGTGTATGCTG
GCACTGAAACCATCGAGATACGCACCGCGAACGCGACGCGCTATGCGCGTGGCATCGATTTCAAGGACTA
TGCGAGCCACACCGAGCCGGGCATTTTGAACGGCCTGATGTATAGCGATTACGAGTACGTCATCACACAA
TCCTTCAGCTTCATGACAAAGCGGGATGGCAAGGAGTTCCTGACACGGCAAAAGCAGCGGCTCCAAAATA
CCGAAGACGGCAGCGCATCCCAGATCATGGAAATGGACATTGCCATCGACCAGCTCGGCCAGGGCGATTT
CGTCATGGGTGAATATCATTATTCGCTGCTGGTATTTGCCGAAGACATGGAGACGGTGCGCCACAACACA
TCACATGCGATGAACATCCTGCAAGACAATGGTTTTCTGGCGACGGTGATCGCCACGGCCACGGATGCGG
CGTTCTATGCACAACTGCCATGTAACTGGCGGTATCGGCCGCGCGTGGCGGGCCTGACCTCGCTCAACTT
CGCCGGTCTGTCATGTTTCCATAATTTCCGCGCAGGCAAGCGGGATGGCAACCCCTGGGGGCAGGCATTG
ACGCTGCTCAAAACCCCTTCCGGACAGCCCGCCTACCTGAACTTCCACTATTCAAAAGGCGACGAAGACA
ACTTCGACAAGAAGCTTCTGGGCAATACCCGCATCATCGGCCAGTCCGGCGCTGGTAAAACTGTCCTGAT
GAACTTCTGCCTCGCGCAAGCGCAGAAGTATTTGCACAATGCTCCGATGGGTATGTGCAACGTCTTTTTC
GACAAGGATCAAGGCGCGAAAGGGACTATTCTTGCCATTGGCGGCAAATACCTTGCCATCAGGAACGGCG
AACCCACCGGGTTCAACCCATTCCAGATGGAGCCAACAGCGGGGAACATCCTGTTCCTTGAAAAACTCGT
ACAGGTACTGGTATCGCGTGATGGCCAGCACGTGACCACAACGGACGAAAGCCGGATCAGTCATGCCATA
CGTACGGTCATGCGCATGCGCCCGGAGCTGCGGCGTCTGTCGACGGTGCTGCAAAACGTTACCGAAGGCA
GCGACCGCCAAGATCGTGAAAACAGCGTGGCGAAGCGGCTCGCGAAGTGGTGTTTTGATGACGGCACCGG
CAAGCGGGGCACATTCTGGTGGGTGCTGGATTGCCCGCAAGACCAGATCGACTTCAACACGCATAGCAAT
TACGGTTTCGATGGCACCGACTTCCTCGACAACGCCGACGTGCGTACGCCGATTTCCATGTACCTGCTGC
ATCGTATGGAATTGGCTATCGACGGGCGTCGTTTCATCTACTGGATGGACGAGGCGTGGAAGTGGGTAGA
CGACGAAGCATTCAGCGAGTTCGCCAATAACAAGCAGCTTACCATCCGCAAGCAAAACGGCCTGGGCGTG
TTTGCCACGCAAATGCCCTCCAGCCTGCTCAACTCCAAAGTCGCGTCGGCCCTGGTGCAACAGGTGGCGA
CGGAAATCTATCTGCCGAATCCGAAAGCCGATTATCACGAGTACACGGACGGCTTCAAGGTGACGAACGA
GGAGTTCGACATCATCCGCAGTATGAGCGAGGAAAGCCGCATGTTCCTGGTCAAGCAGGGGCATCATTCG
ATGATTTGCCGCCTGGAGCTTAATGGCTTTGATGACGAACTGGCGATCCTCTCAGGCAGCTCGGACAACA
ACGAGTTGCTGGACCAGGTCATTGCCGAAGTCGGGGACGACCCTTCGGTATGGCTTCCGGTGTTCCAGGA
GCGCCGGAAAGCACGCATTGCGTCGTCCAAATCAACAGGAAGGTGA
 Primer design