SecReT4
Protein ID: 340791833
T4SS name [ID]VirB [366]
Gene symbolvirB3
Locus tagBPI_II69
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]65440..65790 [-]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDC9U089
KEGG IDbpp:BPI_II69
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.9e-29, Aligned region: 10..102
Protein Sequence: 116 a.a.     [Download]
>gi|340791833|ref|YP_004757297.1| type IV secretion system protein VirB3 [Brucella pinnipedialis B2/94]
MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLIVPIVLVMRQI
TQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES
 
Nucleotide Sequence: 351 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c65790-65440 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGACAACGGCACCACAGGAATCCAACGCACGAAGCGCAGGTTATCGCGGCGATCCAATATTCAAGGGCT
GTACACGGCCAGCCATGTTGTTTGGGGTTCCTGTGATCCCGCTTGTCATCGTTGGCGGCAGCATCGTTCT
CTTATCGGTCTGGATTTCCATGTTCATATTGCCGCTGATCGTACCAATCGTGCTGGTCATGCGGCAGATC
ACGCAGACTGACGATCAGATGTTCCGCCTGCTCGGCCTGAAGGCGCAATTCCGCCTGATCCACTTCAACC
GCACCGGGCGCTTCTGGCGGGCATCCGCCTATAGCCCGATTGCCTTCACAAAGCGCAAAAGAGAATCATG
A
 Primer design