SecReT4
Protein ID: 340791834
T4SS name [ID]VirB [366]
Gene symbolvirB2
Locus tagBPI_II70
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]65804..66121 [-]
Producttype IV secretion system protein VirB2
Component typeVirB2
UniProt IDC9U090
KEGG IDbpp:BPI_II70
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.5e-21, Aligned region: 7..103
Protein Sequence: 105 a.a.     [Download]
>gi|340791834|ref|YP_004757298.1| type IV secretion system protein VirB2 [Brucella pinnipedialis B2/94]
MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSG
YKMAFRHARFMDVVPVLGGALVVGAAAEIASYLLR
 
Nucleotide Sequence: 318 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c66121-65804 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGAAAACCGCTTCCCCCAGCAAGAAGTCGCTGTCGCGGATTCTACCTCACCTACTGCTGGCCCTCATTG
TCTCCATCGCTGCAATCGAGCCTAACCTGGCGCACGCCAACGGTGGCCTCGATAAGGTAAATACAAGCAT
GCAAAAAGTGCTGGACTTGCTAAGCGGCGTATCGATCACCATCGTTACCATAGCCATCATCTGGTCCGGT
TACAAGATGGCATTCCGGCACGCCCGCTTCATGGATGTAGTGCCGGTGCTGGGCGGCGCCCTGGTGGTTG
GCGCTGCCGCCGAAATTGCCTCTTACCTGCTTAGGTAA
 Primer design