SecReT4
Protein ID: 340791835
T4SS name [ID]VirB [366]
Gene symbolvirB1
Locus tagBPI_II71
StrainBrucella pinnipedialis B2/94
Repliconchromosome 2 [GenBank: NC_015858] [Browse all T4SS(s) in this replicon]
Location [Strand]66556..67272 [-]
Producttype IV secretion system protein VirB1
Component typeVirB1
UniProt IDF9YLM6
KEGG IDbpp:BPI_II71
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.7e-20, Aligned region: 5..136
Protein Sequence: 238 a.a.     [Download]
>gi|340791835|ref|YP_004757299.1| type IV secretion system protein VirB1 [Brucella pinnipedialis B2/94]
MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVRQPVSLDEAITTAQSLEAKGWNFSLGI
AQVNRYNLPKYGSTYAQAFDPCKNLKMGSKILEDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTK
PGSPSYVQKVVASADVTTKPIAVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGAAN
APVRLKTEQPATTDAPPGKDNTDGVVVF
 
Nucleotide Sequence: 717 bp     [Download]
>gi|340791767|ref|NC_015858.1|:c67272-66556 Brucella pinnipedialis B2/94 chromosome 2, complete sequence
ATGGTGCCATTCCTTGTCCTCGCGCAACAATGCGCACCGACTGTTGCACCTCAGACTATGGCAGCAATCG
TGCAGGTCGAGTCGGGCTTCAATCCTTATGCAATAGGCGTCGTTGGTGGGCGGTTGGTCCGTCAACCCGT
TTCCCTTGATGAAGCAATCACGACAGCACAGTCACTGGAAGCCAAAGGCTGGAATTTCTCTTTGGGTATT
GCTCAAGTCAACAGGTACAATCTGCCGAAATATGGCAGCACCTATGCACAAGCGTTCGACCCCTGCAAGA
ACCTGAAGATGGGATCCAAGATCCTTGAAGACTGCTACCGTCGGGCCATCGTGAAGATGCCCGGTCAGGA
ACAAGGCGCGCTTCGCGCCGCATTCTCCTGTTACTACGCCGGCAACTTTACGGGCGGCTTCAAGACGAAG
CCCGGCAGTCCCAGCTACGTGCAGAAGGTCGTGGCAAGCGCCGACGTGACCACAAAGCCGATTGCTGTCG
TGCCCATGATCCGGAAAACGCCGGATGCGGCGGCAGCAGTAGCTGCCCCAGTAAAAAAACGACAGCCGGC
TGATCGTAATTCTGTTCTTGTCGATCTGCATCCATCATCGCAGTCGATGCCAGCCACCGGCGCGGCGAAC
GCGCCTGTAAGGCTGAAGACAGAGCAGCCGGCGACAACCGATGCGCCGCCAGGGAAGGATAATACGGACG
GCGTAGTTGTTTTCTAA
 Primer design