SecReT4
Protein ID: 340843790
T4SS name [ID]Tra_I [186]
Gene symbol-
Locus tagpGRT1_p003
StrainPseudomonas putida plasmid pGRT1 (NC_015855)
Repliconplasmid pGRT1 [GenBank: NC_015855] [Browse all T4SS(s) in this replicon]
Location [Strand]6387..6935 [-]
ProductTraL
Component typeTraL_I
UniProt IDG0WPC0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 182 a.a.     [Download]
>gi|340843790|ref|YP_004750540.1| TraL [Pseudomonas putida DOT-T1E]
MMLLAVECSWRTGMKTLTRALLVVLLMSSAVTAHAATCRSGEAAVRGGEAGLARDQDAADTNQTAAQTSS
DILGKCVGGITGIFSTTSFPDLSAIWQMIKDKVCSIASSSVNGVISEVNGQINGVMSEVNGAVTDAVNQT
GVNDTGLGTVVGSGDTHISNPVEVGHTSDAADSSTNWNEVWK
 
Nucleotide Sequence: 549 bp     [Download]
>gi|340843787|ref|NC_015855.1|:c6935-6387 Pseudomonas putida plasmid pGRT1, complete sequence
TTGATGCTCCTGGCCGTTGAATGTTCTTGGAGGACTGGTATGAAGACACTGACCCGCGCGTTACTCGTTG
TGCTGCTCATGAGCTCGGCTGTGACAGCCCATGCTGCCACCTGCCGTAGCGGAGAAGCCGCGGTGCGTGG
TGGTGAGGCCGGCCTGGCTCGAGATCAGGACGCGGCCGACACCAACCAAACGGCTGCTCAGACATCGTCA
GACATTTTGGGCAAATGTGTCGGAGGGATCACCGGCATATTCAGCACTACTTCATTCCCTGATCTTTCTG
CCATCTGGCAAATGATCAAGGACAAGGTTTGCTCGATTGCCAGCTCCTCAGTAAACGGTGTGATTTCCGA
AGTGAATGGACAGATCAACGGCGTCATGAGCGAGGTTAACGGGGCCGTGACTGATGCTGTCAATCAAACG
GGCGTCAACGATACCGGCCTTGGCACCGTCGTCGGTAGCGGTGATACGCACATCAGCAACCCCGTAGAGG
TCGGACACACCAGTGACGCGGCCGATTCATCAACAAATTGGAATGAAGTCTGGAAATAA
 Primer design