SecReT4
Protein ID: 340843837
T4SS name [ID]Tra_I [186]
Gene symbol-
Locus tagpGRT1_p050
StrainPseudomonas putida plasmid pGRT1 (NC_015855)
Repliconplasmid pGRT1 [GenBank: NC_015855] [Browse all T4SS(s) in this replicon]
Location [Strand]52468..53217 [+]
Producttransfer protein TraM
Component typeTraM_I
UniProt IDG0WPG7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 2.3e-24, Aligned region: 103..207
Protein Sequence: 249 a.a.     [Download]
>gi|340843837|ref|YP_004750587.1| transfer protein TraM [Pseudomonas putida DOT-T1E]
MTDTKDAAAPHLDQPGSMQDLGHAAYERELMAIAEKLHQNKDAVDPIARDLEDRKQLAKHTSSIVKSNLV
LSWGLGISICLNCVFGWFVMHPHYVYFAADGLRIVRLVPLNEPYITDAEAIQFAREALNRSMTINFTDYR
QQLEDVRGDWTKRGFAQYLEQLQSAGYLDLVKTKRMNMTVTTETGVLVKSEMVDGVLVRHIEVPIEIKLV
GQTTDLQPKRFIAKVPVARIPTLDSIVGVGLDGIVTTPR
 
Nucleotide Sequence: 750 bp     [Download]
>gi|340843787|ref|NC_015855.1|:52468-53217 Pseudomonas putida plasmid pGRT1, complete sequence
ATGACCGACACCAAGGACGCTGCAGCGCCGCATCTTGATCAGCCTGGATCAATGCAGGATCTCGGCCATG
CAGCATACGAACGAGAGCTGATGGCCATCGCTGAAAAACTGCATCAGAACAAGGATGCCGTCGATCCAAT
CGCACGCGATCTCGAAGACCGTAAGCAGTTGGCTAAACATACGTCCAGCATCGTGAAATCAAACCTGGTT
TTGTCTTGGGGGCTGGGGATCTCGATCTGCCTGAACTGCGTGTTTGGGTGGTTTGTCATGCACCCGCATT
ACGTGTACTTCGCAGCCGATGGTCTACGGATCGTCAGGCTGGTTCCTCTCAATGAGCCGTACATTACCGA
CGCCGAGGCAATTCAGTTTGCCCGTGAAGCTTTGAACCGTTCGATGACGATCAATTTCACCGACTACAGG
CAACAGCTTGAGGACGTGCGTGGCGATTGGACCAAACGCGGGTTCGCTCAGTATTTGGAGCAGTTGCAGT
CTGCCGGCTACCTGGACCTCGTCAAAACCAAGCGCATGAATATGACGGTTACTACGGAAACCGGTGTGCT
TGTGAAATCCGAGATGGTTGACGGTGTTCTCGTGCGCCATATCGAAGTACCGATCGAGATCAAGCTGGTC
GGCCAAACCACCGACCTTCAACCCAAGCGATTCATCGCCAAAGTGCCTGTCGCACGTATTCCCACACTGG
ATTCCATCGTGGGCGTAGGGCTGGACGGCATTGTCACCACGCCCAGGTAA
 Primer design